Recombinant Human HDC2/PHC2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human HDC2/PHC2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human PHC2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PYLQESKEEGAPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGAATHNRRRASKASLPPLTKDTKKQPTGTVPLSVTAALQLTHSQE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PHC2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HDC2/PHC2 Protein

  • early development regulator 2 (homolog of polyhomeotic 2)
  • Early development regulatory protein 2
  • EDR2
  • HPH2
  • MGC163502
  • PH2
  • polyhomeotic 2
  • polyhomeotic homolog 2 (Drosophila)
  • polyhomeotic-like 2 (Drosophila)
  • polyhomeotic-like 2
  • polyhomeotic-like protein 2

Background

In Drosophila melanogaster, the 'Polycomb' group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein 'polyhomeotic' (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-84896
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP2-03348
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA

Publications for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01) (0)

There are no publications for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01) (0)

There are no reviews for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HDC2/PHC2 Products

Bioinformatics Tool for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01)

Discover related pathways, diseases and genes to HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01)

Discover more about diseases related to HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01).
 

Pathways for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01)

View related products by pathway.

PTMs for HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01)

Learn more about PTMs related to HDC2/PHC2 Partial Recombinant Protein (H00001912-Q01).

Blogs on HDC2/PHC2

There are no specific blogs for HDC2/PHC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMI-1 Antibody
NBP1-33748
AGXT Antibody
NBP1-89200

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HDC2/PHC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHC2