Home » HCCA2 » HCCA2 Antibodies » HCCA2 Antibody

HCCA2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HCCA2 Antibody [NBP2-83034] - Host: Rabbit. Target Name: MOB2. Sample Tissue: Human Liver Tumor. Antibody Dilution: 1.0ug/ml
Western Blot: HCCA2 Antibody [NBP2-83034] - Host: Rabbit. Target Name: MOB2. Sample Tissue: Human Liver Tumor. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HCCA2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HCCA2. Peptide sequence: QTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MOB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HCCA2 Antibody

  • HCCA2Mob2 homolog
  • Mps one binder kinase activator-like 2

Background

Stimulates the autophosphorylation and kinase activity of STK38 and STK38L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

STK38 Antibody
(2G8-1F3)
H00011329-M01
Immunohistochemistry-Paraffin: STK38 Antibody (2G8-1F3) [H00011329-M01] - STK38 ( Cat# H00011329-M01 ) on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]
Immunocytochemistry/Immunofluorescence: STK38 Antibody (2G8-1F3) [H00011329-M01] - Analysis of monoclonal antibody to STK38 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: STK38 Antibody (2G8-1F3) [H00011329-M01] - Analysis of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue Antibody concentration 5 ug/ml.
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Sphingomyelin
synthase 1 Antibody
NBP1-92435
Immunohistochemistry-Paraffin: Sphingomyelin synthase 1 Antibody [NBP1-92435] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Western Blot: Sphingomyelin synthase 1 Antibody [NBP1-92435] - Analysis in human lung tissue.
Immunohistochemistry-Paraffin: Sphingomyelin synthase 1 Antibody [NBP1-92435] - Staining of human stomach shows strong granular cytoplasmic psotivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MOBKL1B Antibody
(2D3D11) - BSA Free
NBP2-61873
ELISA: MOBKL1B Antibody (2D3D11) [NBP2-61873] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: MOBKL1B Antibody (2D3D11) [NBP2-61873] - Analysis of Hela cells using MOB1A mouse mAb (green) and negative control (red).
Western Blot: MOBKL1B Antibody (2D3D11) [NBP2-61873] - Analysis using MOB1A mAb against HEK293 (1) and MOB1A (AA: 1-216)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: ELISA, Flow, WB
MOB4A Antibody
(OTI3G9)
NBP2-02715
Western Blot: MOB4A Antibody (3G9) [NBP2-02715] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MOB4A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MOB4A.
Immunohistochemistry-Paraffin: MOB4A Antibody (3G9) [NBP2-02715] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-MOB4A mouse monoclonal antibody.
Immunohistochemistry-Paraffin: MOB4A Antibody (3G9) [NBP2-02715] - Staining of paraffin-embedded Human Kidney tissue using anti-MOB4A mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Hemogen Antibody
NBP1-84907
Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Staining of human bone marrow shows high expression.
Western Blot: Hemogen Antibody [NBP1-84907] - Analysis in control (vector only transfected HEK293T lysate) and HEMGN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Hemogen Antibody [NBP1-84907] - Analysis in human bone marrow and cerebral cortex tissues. Corresponding HEMGN RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
MOBKL3 Antibody
NBP3-03372
Immunohistochemistry-Paraffin: MOBKL3 Antibody [NBP3-03372] - Paraffin-embedded human oophoroma using MOBKL3 antibody at dilution of 1:100 (40x lens).
Western Blot: MOBKL3 Antibody [NBP3-03372] - Analysis of extracts of various cell lines, using MOBKL3 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit,
Immunohistochemistry-Paraffin: MOBKL3 Antibody [NBP3-03372] - Paraffin-embedded rat ovary using MOBKL3 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ACE-2 Antibody
[Unconjugated]
AF933
Western blot shows lysates of human ovary tissue, human testis tissue, and human kidney tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human ACE‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF933) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for ACE‑2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human kidney tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE‑2 at approximately 155 kDa (as indicated) using 10 µg/mL of Goat Anti-Human ACE‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF933) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
HEK293 human embryonic kidney cell line transfected with human ACE-2 and eGFP was stained with (A) Goat Anti-Human ACE-2 Affinity Purified Polyclonal Antibody (Catalog # AF933) or (B) Goat IgG control antibody (Catalog # AB-108-C) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). View our protocol for Staining Membrane-associated Proteins.
(1 Review)
(104 Publications)
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
NDRG1 Antibody
NBP1-86636
Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in human cell lines HEK293 and MCF-7. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Analysis in human prostate and skeletal muscle tissues. Corresponding NDRG1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human colon shows strong membranous positivity in glandular cells.
(5 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MST2/STK3 Antibody
(OTI4G10)
NBP1-48017
Immunohistochemistry-Paraffin: MST2/STK3 Antibody (4G10) [NBP1-48017] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-MST2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: MST2/STK3 Antibody (4G10) [NBP1-48017] - Staining of paraffin-embedded Carcinoma of kidney tissue using anti-MST2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: MST2/STK3 Antibody (4G10) [NBP1-48017] - Staining of paraffin-embedded colon tissue using anti-MST2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
STK38L Antibody
(OTI4D8)
NBP2-45983
Immunocytochemistry/Immunofluorescence: STK38L Antibody (OTI4D8) [NBP2-45983] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY STK38L.
Immunohistochemistry: STK38L Antibody (OTI4D8) [NBP2-45983] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: STK38L Antibody (OTI4D8) [NBP2-45983] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAD2L2 Antibody
(7B6I2)
NBP3-16451
Immunohistochemistry-Paraffin: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Immunohistochemistry of paraffin-embedded rat brain using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Immunohistochemistry of paraffin-embedded human colon using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: MAD2L2 Antibody (7B6I2) [NBP3-16451] - Immunohistochemistry of paraffin-embedded mouse brain using MAD2B/MAD2L2 Rabbit mAb (NBP3-16451) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
YY1AP1 Antibody
NBP1-81763
Immunohistochemistry-Paraffin: YY1AP1 Antibody [NBP1-81763] Staining of human kidney shows strong cytoplasmic and membranous positivity in tubules.
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
FRY Antibody
NBP2-14510
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: FRY Antibody [NBP2-14510] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
MPST Antibody
NBP1-82617
Western Blot: MPST Antibody [NBP1-82617] - Analysis in human cell lines HEK293 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunocytochemistry/Immunofluorescence: MPST Antibody [NBP1-82617] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
(10 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
CAB39 Antibody
NBP2-15658
Western Blot: CAB39 Antibody [NBP2-15658] - Sample (30 ug of whole cell lysate) A: HeLa B: HCT116 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: CAB39 Antibody [NBP2-15658] - CAB39 antibody detects CAB39 protein at Cytoplasm by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CAB39 protein stained by CAB39 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: CAB39 Antibody [NBP2-15658] - Analysis of paraffin-embedded TOV21G xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Moesin Antibody
(MSN/492)
NBP2-44579
Immunohistochemistry-Paraffin: Moesin Antibody (MSN/492) [NBP2-44579] - Human Testicular Carcinoma stained with Moesin Monoclonal Antibody (MSN/492)
Flow Cytometry: Moesin Antibody (MSN/492) [NBP2-44579] - Flow Cytometric Analysis of K562 cells. Moesin Antibody (MSN/492) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
Immunocytochemistry/Immunofluorescence: Moesin Antibody (MSN/492) [NBP2-44579] - Immunofluorescent staining of paraformaldehyde-fixed HeLa cells. followed by goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Red Dot (Red)
(1 Publication)
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Recombinant Human
TBCD GST (N-Term) Pro ...
H00006904-P01
SDS-Page: TBCD Recombinant Protein [H00006904-P01]
Species: Hu
Applications: ELISA, AP, PA, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry: Transthyretin/Prealbumin Antibody (2E10C5) [NBP2-52575] - Analysis of A549 cells using TTR mouse mAb (green) and negative control (red).
Immunocytochemistry/Immunofluorescence: Transthyretin/Prealbumin Antibody (2E10C5) [NBP2-52575] - Analysis of A549 cells using TTR mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Immunocytochemistry/Immunofluorescence: Transthyretin/Prealbumin Antibody (2E10C5) [NBP2-52575] - Analysis of MCF-7 cells using TTR mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
FAM126A Antibody
NBP1-32914
Western Blot: FAM126A Antibody [NBP1-32914] - Sample (50 ug of whole cell lysate) A: mouse brain 7. 5% SDS PAGE, antibody diluted at 1:3000.
Western Blot: FAM126A Antibody [NBP1-32914] - Sample (30 ug of whole cell lysate) A: Raji 7. 5% SDS PAGE; antibody diluted at 1:10000.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
HCCA2 Antibody
NBP2-83034
HCCA2 Antibody
Species: Hu
Applications: WB

Publications for HCCA2 Antibody (NBP2-83034) (0)

There are no publications for HCCA2 Antibody (NBP2-83034).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HCCA2 Antibody (NBP2-83034) (0)

There are no reviews for HCCA2 Antibody (NBP2-83034). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HCCA2 Antibody (NBP2-83034) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HCCA2 Products

Bioinformatics Tool for HCCA2 Antibody (NBP2-83034)

Discover related pathways, diseases and genes to HCCA2 Antibody (NBP2-83034). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HCCA2 Antibody (NBP2-83034)

Discover more about diseases related to HCCA2 Antibody (NBP2-83034).
 

Pathways for HCCA2 Antibody (NBP2-83034)

View related products by pathway.

PTMs for HCCA2 Antibody (NBP2-83034)

Learn more about PTMs related to HCCA2 Antibody (NBP2-83034).

Blogs on HCCA2

There are no specific blogs for HCCA2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HCCA2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MOB2