Recombinant Human HCC1 Protein

Images

 
SDS-Page: Recombinant Human HCC1 Protein [H00009584-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human HCC1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 423-472 of Human HCC1

Source: Wheat Germ

Amino Acid Sequence: TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RBM39
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
31.24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HCC1 Protein

  • CAPER
  • CC1.3
  • coactivator of activating protein-1 and estrogen receptors
  • DKFZp781C0423
  • FLJ44170
  • fSAP59
  • functional spliceosome-associated protein 59
  • HCC1CAPERalpha
  • Hepatocellular carcinoma protein 1
  • RNA binding motif protein 39
  • RNA-binding motif protein 39
  • RNA-binding protein 39
  • RNA-binding region-containing protein 2
  • RNPC2
  • RRM) containing 2
  • splicing factor CC1.3
  • Splicing factor HCC1

Background

RNPC2 - RNA-binding region (RNP1, RRM) containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33397
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
7954-GM/CF
Species: Hu
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC

Publications for HCC1 Partial Recombinant Protein (H00009584-Q01) (0)

There are no publications for HCC1 Partial Recombinant Protein (H00009584-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HCC1 Partial Recombinant Protein (H00009584-Q01) (0)

There are no reviews for HCC1 Partial Recombinant Protein (H00009584-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HCC1 Partial Recombinant Protein (H00009584-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HCC1 Partial Recombinant Protein (H00009584-Q01)

Discover related pathways, diseases and genes to HCC1 Partial Recombinant Protein (H00009584-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HCC1 Partial Recombinant Protein (H00009584-Q01)

Discover more about diseases related to HCC1 Partial Recombinant Protein (H00009584-Q01).
 

Pathways for HCC1 Partial Recombinant Protein (H00009584-Q01)

View related products by pathway.

Research Areas for HCC1 Partial Recombinant Protein (H00009584-Q01)

Find related products by research area.

Blogs on HCC1

There are no specific blogs for HCC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GM-CSF
7954-GM-010/CF
HCC1 Antibody
NBP1-88200

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HCC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM39