HCC1 Antibody (4G8) - Azide and BSA Free

Western Blot: HCC1 Antibody (4G8) [H00009584-M01] - RNPC2 monoclonal antibody (M01), clone 4G8. Analysis of RNPC2 expression in NIH/3T3.

Immunocytochemistry/Immunofluorescence: HCC1 Antibody (4G8) [H00009584-M01] - Analysis of monoclonal antibody to RNPC2 on HeLa cell. Antibody concentration 40 ug/ml.

Immunohistochemistry-Paraffin: HCC1 Antibody (4G8) [H00009584-M01] - Analysis of monoclonal antibody to RNPC2 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 1 ug/ml.

Western Blot: HCC1 Antibody (4G8) [H00009584-M01] - RNPC2 monoclonal antibody (M01), clone 4G8 Analysis of RNPC2 expression in Hela S3 NE.

Western Blot: HCC1 Antibody (4G8) [H00009584-M01] - Analysis of RBM39 expression in transfected 293T cell line by RNPC2 monoclonal antibody (M01), clone 4G8.Lane 1: RBM39 transfected lysate(58.7 KDa).Lane 2: Non-transfected lysate.

ELISA: HCC1 Antibody (4G8) [H00009584-M01] - Detection limit for recombinant GST tagged RNPC2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 4G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HCC1 Antibody (4G8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse HCC1 Antibody (4G8) - Azide and BSA Free (H00009584-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RNPC2 (NP_909122, 423 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
• Specificity: RNPC2 (4G8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RBM39
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HCC1 Antibody (4G8) - Azide and BSA Free

• CAPER alpha
• CAPER
• CAPERalpha
• CC1.3
• coactivator of activating protein-1 and estrogen receptors
• DKFZp781C0423
• FLJ44170
• fSAP59
• functional spliceosome-associated protein 59
• HCC1
• HCC1CAPERalpha
• Hepatocellular carcinoma protein 1
• RBM39
• RNA binding motif protein 39
• RNA-binding motif protein 39
• RNA-binding protein 39
• RNA-binding region-containing protein 2
• RNPC2
• RRM) containing 2
• splicing factor CC1.3
• Splicing factor HCC1

Background

The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM39
• Entrez:
  • 9584(Human)
• OMIM:
  • 604739(Human)
• Uniprot:
  • NP_909122(Human)