HBXIP Antibody

Images

 
Immunohistochemistry-Paraffin: HBXIP Antibody [NBP1-82664] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HBXIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMTOR5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HBXIP Protein (NBP1-82664PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HBXIP Antibody

  • HBV X-interacting protein
  • HBX-interacting protein
  • hepatitis B virus x interacting protein
  • hepatitis B virus x-interacting protein (9.6kD)
  • MGC71071
  • XIPhepatitis B virus X-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
2980-PI
Species: Hu
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-87974
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NBP2-48980
Species: Hu
Applications: IHC
NB120-2869
Species: Hu, Mu, Rt, Po, Bv, Ca, GP, I, Kg, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for HBXIP Antibody (NBP1-82664) (0)

There are no publications for HBXIP Antibody (NBP1-82664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HBXIP Antibody (NBP1-82664) (0)

There are no reviews for HBXIP Antibody (NBP1-82664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HBXIP Antibody (NBP1-82664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HBXIP Products

Bioinformatics Tool for HBXIP Antibody (NBP1-82664)

Discover related pathways, diseases and genes to HBXIP Antibody (NBP1-82664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for HBXIP Antibody (NBP1-82664)

Find related products by research area.

Blogs on HBXIP

There are no specific blogs for HBXIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HBXIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMTOR5