HBQ1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RHYPGDFSPALQASLDKFLSHVISALVSEYR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HBQ1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HBQ1 Antibody - BSA Free
Background
The HBQ1 gene codes a hemoglobin subunit theta-1 protein that is 142 amino acids long at a mass of approximately 15 kDA. The HBQ1 gene is found in human fetal erythroid tissue as it is expressed early in embryonic life (before 5 weeks) and is part of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. HBQ1 has interactions with genes AHSP, HBA1, HBA2, HBB, and CYB5R3. Research has linked the HBQ1 gene to thalassemia and hemoglobinopathy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: Flow, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for HBQ1 Antibody (NBP2-38960) (0)
There are no publications for HBQ1 Antibody (NBP2-38960).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HBQ1 Antibody (NBP2-38960) (0)
There are no reviews for HBQ1 Antibody (NBP2-38960).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HBQ1 Antibody (NBP2-38960) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HBQ1 Products
Research Areas for HBQ1 Antibody (NBP2-38960)
Find related products by research area.
|
Blogs on HBQ1