![Immunocytochemistry/Immunofluorescence: HBQ1 Antibody [NBP2-38960] - Staining of human cell line U-2 OS shows localization to lipid droplets.](http://images.novusbio.com/fullsize/HBQ1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38960-img0002.jpg "Immunocytochemistry/Immunofluorescence: HBQ1 Antibody [NBP2-38960] - Staining of human cell line U-2 OS shows localization to lipid droplets.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit HBQ1 Antibody - BSA Free (NBP2-38960) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RHYPGDFSPALQASLDKFLSHVISALVSEYR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HBQ1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HBQ1 Antibody (NBP2-38960)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: HBQ1 Antibody [NBP2-38960] - Staining of human colon shows low expression as expected.](http://images.novusbio.com/fullsize/HBQ1-Antibody-Immunohistochemistry-Paraffin-NBP2-38960-img0004.jpg "Immunohistochemistry-Paraffin: HBQ1 Antibody [NBP2-38960] - Staining of human colon shows low expression as expected.")
![Immunohistochemistry-Paraffin: HBQ1 Antibody [NBP2-38960] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize/HBQ1-Antibody-Immunohistochemistry-Paraffin-NBP2-38960-img0003.jpg "Immunohistochemistry-Paraffin: HBQ1 Antibody [NBP2-38960] - Staining of human bone marrow shows high expression.")
![Immunohistochemistry-Paraffin: HBQ1 Antibody [NBP2-38960] - Staining in human bone marrow and colon tissues using anti-HBQ1 antibody. Corresponding HBQ1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HBQ1-Antibody-Immunohistochemistry-Paraffin-NBP2-38960-img0005.jpg "Immunohistochemistry-Paraffin: HBQ1 Antibody [NBP2-38960] - Staining in human bone marrow and colon tissues using anti-HBQ1 antibody. Corresponding HBQ1 RNA-seq data are presented for the same tissues.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")