HAUS3 Antibody

Images

 
Immunohistochemistry-Paraffin: HAUS3 Antibody [NBP2-14630] Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HAUS3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQ NVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELE KLEDEVQTLLKLKNLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAUS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HAUS3 Protein (NBP2-14630PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HAUS3 Antibody

  • C4orf15
  • dgt3
  • HAUS3 HAUS augmin-like complex, subunit 3
  • IT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-13665
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06757
Species: Hu
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74570
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-61107
Species: Hu
Applications: WB, IP
NBP1-54918
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP2-15937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-94011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14522
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-61614
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-14630
Species: Hu
Applications: IHC, IHC-P

Publications for HAUS3 Antibody (NBP2-14630) (0)

There are no publications for HAUS3 Antibody (NBP2-14630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HAUS3 Antibody (NBP2-14630) (0)

There are no reviews for HAUS3 Antibody (NBP2-14630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HAUS3 Antibody (NBP2-14630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HAUS3 Products

HAUS3 NBP2-14630

Bioinformatics Tool for HAUS3 Antibody (NBP2-14630)

Discover related pathways, diseases and genes to HAUS3 Antibody (NBP2-14630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HAUS3 Antibody (NBP2-14630)

Discover more about diseases related to HAUS3 Antibody (NBP2-14630).
 

Pathways for HAUS3 Antibody (NBP2-14630)

View related products by pathway.

Blogs on HAUS3

There are no specific blogs for HAUS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HAUS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAUS3