We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

HARS2 Recombinant Protein Antigen

Images

 
There are currently no images for HARS2 Recombinant Protein Antigen (NBP3-24892PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HARS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HARS2

Source: E.coli

Amino Acid Sequence: LAMNKVKKMKRYHVGKVWRRESPTIVQGRYRE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
HARS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24892It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HARS2 Recombinant Protein Antigen

  • EC 6.1.1
  • EC 6.1.1.21
  • HARSLprobable histidyl-tRNA synthetase, mitochondrial
  • HARS-related
  • HARSRhistidine tRNA ligase 2, mitochondrial (putative)
  • HisRS
  • histidine translase
  • Histidine--tRNA ligase
  • Histidine--tRNA ligase-like
  • histidyl-tRNA synthetase 2, mitochondrial (putative)
  • histidyl-tRNA synthetase-like
  • HO3histidine-tRNA ligase homolog

Background

The HARS2 gene encodes a 506 amino acid, 56kDA probable histidine--tRNA ligase (mitochondrial) protein that is member to the II family of aminoacyl-tRNA synthetases which charge tRNA with cognate amino acids. The HARS2 gene is located in a head-to-head orientation with HARS on chromosome 5, which is the location of where homologous genes share a bidirectional promoter. The protein works as an accessory in the regulation of protein biosynthesis through the synthesis of histidyl-transfer RNA. HARS2 is involved in gene expression and mitochondrian tRNA aminoacylation and has been known to interact with genes ICT1, AARS2, AASS, ABSB7, and ACAD9. HARS2 has been investigated in immunodeficiency, malaria, pneumonia, hearing loss, tuberculosis, schizophrenia, and ovarian dysgenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-56375
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-20567
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-16112
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-01407
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-82294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13640
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86889
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-85937
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-20928
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83854
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02669
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-20262
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-24892PEP
Species: Hu
Applications: AC

Publications for HARS2 Recombinant Protein Antigen (NBP3-24892PEP) (0)

There are no publications for HARS2 Recombinant Protein Antigen (NBP3-24892PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HARS2 Recombinant Protein Antigen (NBP3-24892PEP) (0)

There are no reviews for HARS2 Recombinant Protein Antigen (NBP3-24892PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HARS2 Recombinant Protein Antigen (NBP3-24892PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HARS2 Products

Blogs on HARS2

There are no specific blogs for HARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HARS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HARS2