HARS2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

HARS2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HARS2
  
  

  Source: E.coli

  Amino Acid Sequence: LAMNKVKKMKRYHVGKVWRRESPTIVQGRYRE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: HARS2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24892It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HARS2 Recombinant Protein Antigen

• EC 6.1.1
• EC 6.1.1.21
• HARSLprobable histidyl-tRNA synthetase, mitochondrial
• HARS-related
• HARSRhistidine tRNA ligase 2, mitochondrial (putative)
• HisRS
• histidine translase
• Histidine--tRNA ligase
• Histidine--tRNA ligase-like
• histidyl-tRNA synthetase 2, mitochondrial (putative)
• histidyl-tRNA synthetase-like
• HO3histidine-tRNA ligase homolog

Background

The HARS2 gene encodes a 506 amino acid, 56kDA probable histidine--tRNA ligase (mitochondrial) protein that is member to the II family of aminoacyl-tRNA synthetases which charge tRNA with cognate amino acids. The HARS2 gene is located in a head-to-head orientation with HARS on chromosome 5, which is the location of where homologous genes share a bidirectional promoter. The protein works as an accessory in the regulation of protein biosynthesis through the synthesis of histidyl-transfer RNA. HARS2 is involved in gene expression and mitochondrian tRNA aminoacylation and has been known to interact with genes ICT1, AARS2, AASS, ABSB7, and ACAD9. HARS2 has been investigated in immunodeficiency, malaria, pneumonia, hearing loss, tuberculosis, schizophrenia, and ovarian dysgenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HARS2