HARS2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HARS2 Source: E.coli
Amino Acid Sequence: LAMNKVKKMKRYHVGKVWRRESPTIVQGRYRE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HARS2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24892It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for HARS2 Recombinant Protein Antigen
Background
The HARS2 gene encodes a 506 amino acid, 56kDA probable histidine--tRNA ligase (mitochondrial) protein that is member to the II family of aminoacyl-tRNA synthetases which charge tRNA with cognate amino acids. The HARS2 gene is located in a head-to-head orientation with HARS on chromosome 5, which is the location of where homologous genes share a bidirectional promoter. The protein works as an accessory in the regulation of protein biosynthesis through the synthesis of histidyl-transfer RNA. HARS2 is involved in gene expression and mitochondrian tRNA aminoacylation and has been known to interact with genes ICT1, AARS2, AASS, ABSB7, and ACAD9. HARS2 has been investigated in immunodeficiency, malaria, pneumonia, hearing loss, tuberculosis, schizophrenia, and ovarian dysgenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: AC
Publications for HARS2 Recombinant Protein Antigen (NBP3-24892PEP) (0)
There are no publications for HARS2 Recombinant Protein Antigen (NBP3-24892PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HARS2 Recombinant Protein Antigen (NBP3-24892PEP) (0)
There are no reviews for HARS2 Recombinant Protein Antigen (NBP3-24892PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HARS2 Recombinant Protein Antigen (NBP3-24892PEP) (0)
Additional HARS2 Products
Blogs on HARS2