H2AFJ Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit H2AFJ Antibody - BSA Free (NBP3-09542) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human H2AFJ (NP_808760). Peptide sequence AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
H2AJ |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
13 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for H2AFJ Antibody - BSA Free
Background
Histones are nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber as they play a critical role in transcription regulation, DNA repair, DNA replication, and chromosomal stability. The H2AFJ gene is located on chromosome 12 encodes a histone H2A.J protein that exists in two isoforms: isoform 1 is 129 amino acids long at 14 kDA while isoform 2 is 151 amino acids long at 16 kDA. The protein is divergent at the C-terminus compared to the consensus H2A histone family member. The H2AFJ gene has been researched regarding lupus, nevus, and immunodeficiency and is known to interact with various genes such as H3F3B, CENPA, ASXL2, KIAA1609, and RBBP4.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, , WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, RM
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for H2AFJ Antibody (NBP3-09542) (0)
There are no publications for H2AFJ Antibody (NBP3-09542).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for H2AFJ Antibody (NBP3-09542) (0)
There are no reviews for H2AFJ Antibody (NBP3-09542).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for H2AFJ Antibody (NBP3-09542) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional H2AFJ Products
Blogs on H2AFJ