H1F0 Antibody

Images

 
Western Blot: H1F0 Antibody [NBP1-83308] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-2 OS
Immunocytochemistry/ Immunofluorescence: H1F0 Antibody [NBP1-83308] - Staining of human cell line A-431 shows localization to nucleus & actin filaments.
Immunohistochemistry-Paraffin: H1F0 Antibody [NBP1-83308] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

H1F0 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MTENSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
H1F0
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
H1F0 Protein (NBP1-83308PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for H1F0 Antibody

  • H1 histone family, member 0
  • H1.0, H1(0), H1-0
  • H10
  • H1FVMGC5241
  • Histone H1'
  • Histone H1(0)
  • histone H1.0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NBP2-06757
Species: Hu
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000389-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB4645
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-83308
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for H1F0 Antibody (NBP1-83308) (0)

There are no publications for H1F0 Antibody (NBP1-83308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H1F0 Antibody (NBP1-83308) (0)

There are no reviews for H1F0 Antibody (NBP1-83308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for H1F0 Antibody (NBP1-83308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional H1F0 Products

Bioinformatics Tool for H1F0 Antibody (NBP1-83308)

Discover related pathways, diseases and genes to H1F0 Antibody (NBP1-83308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H1F0 Antibody (NBP1-83308)

Discover more about diseases related to H1F0 Antibody (NBP1-83308).
 

Pathways for H1F0 Antibody (NBP1-83308)

View related products by pathway.

PTMs for H1F0 Antibody (NBP1-83308)

Learn more about PTMs related to H1F0 Antibody (NBP1-83308).

Blogs on H1F0

There are no specific blogs for H1F0, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our H1F0 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol H1F0