GUF1 Antibody

Images

 
Western Blot: GUF1 Antibody [NBP2-58606] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: GUF1 Antibody [NBP2-58606] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GUF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YASFDYEDAGYQTAELVKMDILLNGNTVEELVTVVHKDKAHSIGKAICERLKDSLPRQLFEIAIQAAIGSKIIARETVKAYRKNVLAKCYGGDITRKMKLLKRQAEGKKKLRKIGNVEVPKDA
Specificity
Specificity of human GUF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GUF1 Recombinant Protein Antigen (NBP2-58606PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GUF1 Antibody

  • EC 3.6.5.-
  • EF-4
  • Elongation factor 4 homolog
  • FLJ13220
  • GTPase GUF1
  • GTPase of unknown function 1
  • GTP-binding protein GUF1 homolog
  • GUF1 GTPase homolog (S. cerevisiae)
  • Ribosomal back-translocase
  • translation factor GUF1, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-66296
Species: Hu
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30049
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-55158
Species: Hu
Applications: IHC, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP2-14428
Species: Hu
Applications: IHC, IHC-P
NBP2-58847
Species: Hu
Applications: WB, IHC, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-25169
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC

Publications for GUF1 Antibody (NBP2-58606) (0)

There are no publications for GUF1 Antibody (NBP2-58606).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GUF1 Antibody (NBP2-58606) (0)

There are no reviews for GUF1 Antibody (NBP2-58606). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GUF1 Antibody (NBP2-58606) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GUF1 Antibody (NBP2-58606)

Discover related pathways, diseases and genes to GUF1 Antibody (NBP2-58606). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GUF1 Antibody (NBP2-58606)

Discover more about diseases related to GUF1 Antibody (NBP2-58606).
 

Pathways for GUF1 Antibody (NBP2-58606)

View related products by pathway.

Blogs on GUF1

There are no specific blogs for GUF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GUF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUF1