GTPBP3 Antibody - BSA Free

Western Blot: GTPBP3 Antibody [NBP2-87544] - Host: Rabbit. Target Name: GTPBP3. Sample Tissue: Human PC-3 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

GTPBP3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GTPBP3. Peptide sequence: LREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVAS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTPBP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GTPBP3 Antibody - BSA Free

• FLJ14700
• FLJ17836
• GTP binding protein 3 (mitochondrial)
• GTPBG3
• GTP-binding protein 3
• MSS1
• MTGP1Mitochondrial GTP-binding protein 1
• THDF1
• tRNA modification GTPase GTPBP3, mitochondrial

Background

GTPase involved in the 5-carboxymethylaminomethyl modification (mnm(5)s(2)U34) of the wobble uridine base inmitochondrial tRNAs (Probable)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTPBP3