Home » GTF3C2 » GTF3C2 Proteins » GTF3C2 Recombinant Protein Antigen

GTF3C2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GTF3C2 Protein (NBP1-83062PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

GTF3C2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF3C2.

Source: E.coli

Amino Acid Sequence: LRREPMLRMQEGEGHSQLCLDRLQLEAIHKVRFSPNLDSYGWLVSGGQSGLVRIHFVRGLASPLGHRMQLESRAHFNAMFQPSSPTRRPGFSPTSH
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF3C2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83062.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GTF3C2 Recombinant Protein Antigen

  • general transcription factor 3C polypeptide 2
  • general transcription factor IIIC, polypeptide 2, beta 110kDa
  • KIAA0011general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD)
  • TF3C-beta
  • TFIIIC 110 kDa subunit
  • TFIIIC110Transcription factor IIIC 110 kDa subunit
  • TFIIIC-BETA
  • Transcription factor IIIC subunit beta

Background

General transcription factor 3C polypeptide 2 (GTF3C2/TFIIIC110) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. The functional contribution of GTF3C2/TFIIIC110 to the TFIIIC complex has not been fully determined. TFIIIC that is not associated with GTF3C2/TFIIIC110 has been purified, and it has been proposed that GTF3C2/TFIIIC110 functions to activate the TFIIIC complex for RNA polymerase III transcription. Recent studies argue against this model of GTF3C2/TFIIIC110 function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TFIIIC Antibody
NB100-60657
Immunohistochemistry-Paraffin: TFIIIC Antibody [NB100-60657] - Human prostate carcinoma. Antibody used at a dilution of 1:1,000.
Western Blot: TFIIIC Antibody [NB100-60657] - Detection of Human GTF3C1/TFIIIC220 on HeLa whole cell lysate using NB100-60657. GTF3C1/TFIIIC220 was efficiently IPed by rabbit anti-GTF3C1/TFIIIC220 antibodies NB100-60655 and NB100-60656.
(2 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP (-), WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/Immunofluorescence: SPANXB1 Antibody [H00728695-B01P] - Analysis of purified antibody to SPANXB1 on Hs 181.Tes cell. (antibody concentration 10 ug/ml)
Western Blot: SPANXB1 Antibody [H00728695-B01P] - Analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 polyclonal antibody. Lane 1: SPANXB1 transfected lysate(11.33 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IP, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
Calpain 1 Antibody
NBP2-15671
Immunoprecipitation: Calpain 1 Antibody [NBP2-15671] - Immunoprecipitation of Calpain 1 protein from A431 whole cell extracts using 5 ug of Calpain 1 antibody. Western blot analysis was performed using Calpain 1 antibody.
Western Blot: Calpain 1 Antibody [NBP2-15671] - Calpain 1 antibody detects Calpain 1 protein by western blot analysis. Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Calpain 1 antibody diluted at a dilution of 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Calpain 1 Antibody [NBP2-15671] - Mouse lung. Calpain 1 antibody [N3C2], Internal diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
NS1-BP Antibody
NBP1-83180
Western Blot: NS1-BP Antibody [NBP1-83180] - Analysis in human cell lines U-251MG and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Immunohistochemistry-Paraffin: NS1-BP Antibody [NBP1-83180] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Western Blot: NS1-BP Antibody [NBP1-83180] - Analysis in control (vector only transfected HEK293T lysate) and IVNS1ABP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(31 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
GPR172A Antibody
NBP2-49382
Immunohistochemistry: GPR172A Antibody [NBP2-49382] - Staining of human small intestine shows moderate cytoplasmic and membranous positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
SHP-2/PTPN11 [p
Tyr542] Antibody [Unc ...
AF3790
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 50 ng/mL Human PDGF-BB (Catalog # 220-BB) for 20 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human/Mouse Phospho-SHP‑2 (Y542) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3790), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-SHP‑2 (Y542) at approximately 72 kDa (as indicated). The lysates were also probed for total SHP-2 with Human/Mouse/Rat SHP-2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1894). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 50 ng/mL Recombinant Human PDGF‑BB (Catalog # 220-BB) for 20 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-SHP‑2 (Y542) at approximately 72 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human/Mouse Phospho-SHP‑2 (Y542) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3790). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. *Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Publication)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
PAR1/Thrombin
Receptor Antibody (N2
NBP1-71770
Western Blot: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of PAR1 in whole cell lysate of Neuro2A cell line using 4ug/ml concentration of PAR1 antibody (clone N2-11). The antibody detected a strong band at ~60kDa position and another light band at ~80kDa, both of which appears to be the glycosylated forms of PAR1 protein.
Immunocytochemistry/Immunofluorescence: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Thrombin Receptor antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: PAR1/Thrombin Receptor Antibody (N2-11) [NBP1-71770] - Analysis of Thrombin Receptor on mouse skin using NBP1-71770.
(9 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(1 Publication)
Species: Hu
Applications: DirELISA, IP, WB
Neurofibromin 1
Antibody
NB300-155
Immunohistochemistry: Neurofibromin 1 Antibody [NB300-155] - NF1 protein labeling displays positive signal in the maturing and the hypertrophic cartilages but only faint labeling in the proliferative cartilage.
Western Blot: Neurofibromin 1 Antibody [NB300-155] - Western Blot of (A, B, C above).
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
PLEKHM1 Antibody
NBP2-38449
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human fallopian tube shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human placenta shows moderate granular cytoplasmic postivity in trophoblastic cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Calpain 1 Antibody
NBP2-15671
Immunoprecipitation: Calpain 1 Antibody [NBP2-15671] - Immunoprecipitation of Calpain 1 protein from A431 whole cell extracts using 5 ug of Calpain 1 antibody. Western blot analysis was performed using Calpain 1 antibody.
Western Blot: Calpain 1 Antibody [NBP2-15671] - Calpain 1 antibody detects Calpain 1 protein by western blot analysis. Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with Calpain 1 antibody diluted at a dilution of 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Calpain 1 Antibody [NBP2-15671] - Mouse lung. Calpain 1 antibody [N3C2], Internal diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for GTF3C2 Protein (NBP1-83062PEP) (0)

There are no publications for GTF3C2 Protein (NBP1-83062PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF3C2 Protein (NBP1-83062PEP) (0)

There are no reviews for GTF3C2 Protein (NBP1-83062PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF3C2 Protein (NBP1-83062PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF3C2 Products

Bioinformatics Tool for GTF3C2 Protein (NBP1-83062PEP)

Discover related pathways, diseases and genes to GTF3C2 Protein (NBP1-83062PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GTF3C2

There are no specific blogs for GTF3C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GTF3C2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GTF3C2