GTF3C2 Recombinant Protein Antigen

Images

 
There are currently no images for GTF3C2 Protein (NBP1-83062PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GTF3C2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF3C2.

Source: E. coli

Amino Acid Sequence: LRREPMLRMQEGEGHSQLCLDRLQLEAIHKVRFSPNLDSYGWLVSGGQSGLVRIHFVRGLASPLGHRMQLESRAHFNAMFQPSSPTRRPGFSPTSH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF3C2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83062.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GTF3C2 Recombinant Protein Antigen

  • general transcription factor 3C polypeptide 2
  • general transcription factor IIIC, polypeptide 2, beta 110kDa
  • KIAA0011general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD)
  • TF3C-beta
  • TFIIIC 110 kDa subunit
  • TFIIIC110Transcription factor IIIC 110 kDa subunit
  • TFIIIC-BETA
  • Transcription factor IIIC subunit beta

Background

General transcription factor 3C polypeptide 2 (GTF3C2/TFIIIC110) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. The functional contribution of GTF3C2/TFIIIC110 to the TFIIIC complex has not been fully determined. TFIIIC that is not associated with GTF3C2/TFIIIC110 has been purified, and it has been proposed that GTF3C2/TFIIIC110 functions to activate the TFIIIC complex for RNA polymerase III transcription. Recent studies argue against this model of GTF3C2/TFIIIC110 function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-60657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP (-), WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP2-54591
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-49382
Species: Hu
Applications: IHC,  IHC-P
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB300-155
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC,  IHC-P, IP, WB

Publications for GTF3C2 Protein (NBP1-83062PEP) (0)

There are no publications for GTF3C2 Protein (NBP1-83062PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF3C2 Protein (NBP1-83062PEP) (0)

There are no reviews for GTF3C2 Protein (NBP1-83062PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF3C2 Protein (NBP1-83062PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF3C2 Products

Blogs on GTF3C2

There are no specific blogs for GTF3C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GTF3C2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3C2