GTF2H2 Antibody

Images

 
Western Blot: GTF2H2 Antibody [H00002966-D01P] - Analysis of GTF2H2 expression in transfected 293T cell line by GTF2H2 polyclonal antibody.Lane 1: GTF2H2 transfected lysate(44.40 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTF2H2 Antibody Summary

Immunogen
GTF2H2 (NP_001506.1, 1 a.a. - 395 a.a.) full-length human protein. MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2H2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GTF2H2 Antibody

  • Basic transcription factor 2 44 kDa subunit
  • BTF2 p44
  • BTF2
  • BTF2P44TFIIH basal transcription factor complex p44 subunit
  • General transcription factor IIH polypeptide 2
  • general transcription factor IIH subunit 2
  • general transcription factor IIH, polypeptide 2 (44kD subunit)
  • general transcription factor IIH, polypeptide 2, 44kD subunit
  • general transcription factor IIH, polypeptide 2, 44kDa
  • MGC102806
  • T-BTF2P44
  • TFIIH

Background

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002966-D01P
Species: Hu
Applications: WB

Publications for GTF2H2 Antibody (H00002966-D01P) (0)

There are no publications for GTF2H2 Antibody (H00002966-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H2 Antibody (H00002966-D01P) (0)

There are no reviews for GTF2H2 Antibody (H00002966-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTF2H2 Antibody (H00002966-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTF2H2 Products

Bioinformatics Tool for GTF2H2 Antibody (H00002966-D01P)

Discover related pathways, diseases and genes to GTF2H2 Antibody (H00002966-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2H2 Antibody (H00002966-D01P)

Discover more about diseases related to GTF2H2 Antibody (H00002966-D01P).
 

Pathways for GTF2H2 Antibody (H00002966-D01P)

View related products by pathway.

Research Areas for GTF2H2 Antibody (H00002966-D01P)

Find related products by research area.

Blogs on GTF2H2

There are no specific blogs for GTF2H2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF2H2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2H2
Uniprot