GTF2H2 Antibody

Western Blot: GTF2H2 Antibody [H00002966-D01P] - Analysis of GTF2H2 expression in transfected 293T cell line by GTF2H2 polyclonal antibody.Lane 1: GTF2H2 transfected lysate(44.40 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

GTF2H2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GTF2H2 (NP_001506.1, 1 a.a. - 395 a.a.) full-length human protein. MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GTF2H2
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GTF2H2 Antibody

• Basic transcription factor 2 44 kDa subunit
• BTF2 p44
• BTF2
• BTF2P44TFIIH basal transcription factor complex p44 subunit
• General transcription factor IIH polypeptide 2
• general transcription factor IIH subunit 2
• general transcription factor IIH, polypeptide 2 (44kD subunit)
• general transcription factor IIH, polypeptide 2, 44kD subunit
• general transcription factor IIH, polypeptide 2, 44kDa
• MGC102806
• T-BTF2P44
• TFIIH

Background

This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTF2H2
• Uniprot:
  • NP_001506.1(Human)