GST Epitope Tag Full length Protein

Product Discontinued

GST Epitope Tag Full length Protein Summary

• Description: A recombinant protein corresponding to the amino acids 1 - 242 of GST full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full length Protein
• Gene: GSTM1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 26.4 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GST Epitope Tag Full length Protein

• EC 2.5.1.18
• glutathione S-alkyltransferase
• glutathione S-aralkyltransferase
• glutathione S-aryltransferase
• glutathione S-transferase M1
• glutathione S-transferase mu 1
• GST class-mu 1
• GST HB subunit 4
• GST1
• GSTM1-1
• GSTM1a-1a
• GSTM1b-1b
• GTH4
• GTM1
• HB subunit 4
• H-B
• MGC26563
• MU
• MU-1
• S-(hydroxyalkyl)glutathione lyase

Background

Glutathione S transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunological, and structural properties, the soluble human GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The amino acid sequence GST is highly conserved in most organisms, including mammals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GSTM1