![Western Blot: GSPT1 Antibody [NBP2-87531] - WB Suggested Anti-GSPT1 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole CellGSPT1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells](http://images.novusbio.com/fullsize/GSPT1-Antibody-Western-Blot-NBP2-87531-img0001.jpg "Western Blot: GSPT1 Antibody [NBP2-87531] - WB Suggested Anti-GSPT1 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole CellGSPT1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit GSPT1 Antibody - BSA Free (NBP2-87531) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSPT1. Peptide sequence: AGGRAAPVESSQEEQSLCEGSNSAVSMELSEPIENGETEMSPEESWEHKE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSPT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot Carbohydrate Sulfotransferase 4/CHST4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbohydrate_Sulfotransferase_4_AF5357_Western_Blot_5696.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GSPT1 Antibody (NBP2-87531)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSPT1 |
![Western Blot: GSPT1 Antibody [NBP2-87531] - Host: Rabbit. Target Name: GSPT1. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/GSPT1-Antibody-Western-Blot-NBP2-87531-img0002.jpg "Western Blot: GSPT1 Antibody [NBP2-87531] - Host: Rabbit. Target Name: GSPT1. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml")
![Immunohistochemistry AP-2 gamma Antibody [Unconjugated]](https://images.novusbio.com/images2/AP-2_gamma_AF5059_Immunohistochemistry_6857.jpg)
![Western Blot AP-2 gamma Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af5059_human-ap-2-gamma-affinity-purified-polyclonal-ab-western-blot-1732025101610..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
