GSK-3 beta Antibody (1H3)

Images

 
Immunocytochemistry/ Immunofluorescence: GSK-3 beta Antibody (1H3) [H00002932-M04] - Analysis of monoclonal antibody to GSK3B on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: GSK-3 beta Antibody (1H3) [H00002932-M04] - Analysis of monoclonal antibody to GSK3B on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml
Sandwich ELISA: GSK-3 beta Antibody (1H3) [H00002932-M04] - Detection limit for recombinant GST tagged GSK3B is approximately 3ng/ml as a capture antibody.
Proximity Ligation Assay: GSK-3 beta Antibody (1H3) [H00002932-M04] - Analysis of protein-protein interactions between SMAD1 and GSK3B. HeLa cells were stained with anti-SMAD1 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P, PLA
Clone
1H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GSK-3 beta Antibody (1H3) Summary

Immunogen
GSK3B (NP_002084, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI
Specificity
GSK3B (1H3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSK3B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSK-3 beta Antibody (1H3)

  • EC 2.7.11
  • EC 2.7.11.26
  • glycogen synthase kinase 3 beta
  • glycogen synthase kinase-3 beta
  • GSK3 beta
  • GSK-3 beta
  • GSK3B
  • GSK3beta isoform

Background

Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A; MIM 606784) and beta, show a high degree of amino acid homology (Stambolic and Woodgett, 1994 [PubMed 7980435]). GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation (Plyte et al., 1992 [PubMed 1333807]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002932-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA

Publications for GSK-3 beta Antibody (H00002932-M04) (0)

There are no publications for GSK-3 beta Antibody (H00002932-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSK-3 beta Antibody (H00002932-M04) (0)

There are no reviews for GSK-3 beta Antibody (H00002932-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSK-3 beta Antibody (H00002932-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSK-3 beta Products

Bioinformatics Tool for GSK-3 beta Antibody (H00002932-M04)

Discover related pathways, diseases and genes to GSK-3 beta Antibody (H00002932-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSK-3 beta Antibody (H00002932-M04)

Discover more about diseases related to GSK-3 beta Antibody (H00002932-M04).
 

Pathways for GSK-3 beta Antibody (H00002932-M04)

View related products by pathway.

PTMs for GSK-3 beta Antibody (H00002932-M04)

Learn more about PTMs related to GSK-3 beta Antibody (H00002932-M04).
 

Research Areas for GSK-3 beta Antibody (H00002932-M04)

Find related products by research area.

Blogs on GSK-3 beta.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSK-3 beta Antibody (1H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol GSK3B
Entrez
OMIM
Uniprot