GRP Antibody


Immunocytochemistry/ Immunofluorescence: GRP Antibody [NBP1-91923] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GRP Antibody [NBP1-91923] - Staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

GRP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELK
Specificity of human GRP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRP Protein (NBP1-91923PEP)
Reviewed Applications
Read 1 Review rated 3
NBP1-91923 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GRP Antibody

  • galectin-related protein
  • GRP
  • MGC33751
  • MGC71953


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for GRP Antibody (NBP1-91923) (0)

There are no publications for GRP Antibody (NBP1-91923).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GRP Antibody (NBP1-91923) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-91923:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen GRP NBP1-91923
reviewed by:
Geng Kaiwen
IHC-Fr Mouse 12/05/2017


Sample Tested Mouse brain

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GRP Antibody (NBP1-91923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GRP Antibody (NBP1-91923)

Discover related pathways, diseases and genes to GRP Antibody (NBP1-91923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GRP

There are no specific blogs for GRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Geng Kaiwen
Application: IHC-Fr
Species: Mouse


Gene Symbol LGALSL