GRK3 Antibody - BSA Free

Western Blot: GRK3 Antibody [NBP1-57568] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GRK3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ADRBK2(adrenergic, beta, receptor kinase 2) The peptide sequence was selected from the N terminal of ADRBK2. Peptide sequence FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GRK3 Antibody - BSA Free

• ADRBK2
• adrenergic, beta, receptor kinase 2
• BARK2
• BARK2beta-adrenergic receptor kinase 2
• Beta-ARK-2
• EC 2.7.11
• EC 2.7.11.15
• G-protein-coupled receptor kinase 3
• GRK3
• GRK3Beta-ARK-2

Background

ADRBK2 specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors.The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and ESTs. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-68 BC036797.1 1-68 69-124 BX387339.2 114-169 125-1307 BC036797.1 69-1251 1308-2783 BC036797.1 1402-2877 2784-7732 AL022329.9 173762-178710 7733-9068 BC063545.1 1-1336

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRK3
• Uniprot:
  • P35626()