GRK2 Antibody - BSA Free

Staining of human cell line REH shows localization to cytosol.

Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10Lane 2: RT-4Lane 3: U-251MGLane 4: Human PlasmaLane 5: LiverLane 6: Tonsil

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GRK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GRK2 Antibody - BSA Free (NBP3-24887) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein GRK2 using the following amino acid sequence: LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GRK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GRK2 Antibody - BSA Free

• ADRBK1
• adrenergic, beta, receptor kinase 1
• BARK
• BARK1
• BARK1beta-ARK-1
• Beta-ARK1
• Beta-ARK-1
• EC 2.7.11
• EC 2.7.11.15
• FLJ16718
• G-protein coupled receptor kinase 2
• GRK2
• GRK2beta-adrenergic receptor kinase 1

Background

Adrenergic Receptor beta Kinase 1 (ADRBK1), also known as GRK2, is a member of the G-protein receptor kinase family. A ubiquitous cytosolic enzyme, GRK-2 specifically phosphorylates the beta-2-adrenergic receptor and appears to mediate agonist-specific desensitization observed under high agonist concentrations. Defects in GRK2 coupling with G-protein receptors may lead to heart failure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRK2