Recombinant Human Granzyme M Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Granzyme M Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-109 of Human GZMM partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCL

Protein/Peptide Type
Partial Recombinant Protein
Gene
GZMM

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Granzyme M Protein

  • EC 3.4.21
  • EC 3.4.21.-
  • granzyme M (lymphocyte met-ase 1)
  • granzyme M
  • Hu-Met-1
  • LMET1
  • lymphocyte met-ase 1
  • Met-1 serine protease
  • MET1met-ase
  • Met-ase
  • Natural killer cell granular protease

Background

GZMM - granzyme M (lymphocyte met-ase 1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-58965
Species: Hu
Applications: WB, PEP-ELISA
AF2200
Species: Hu
Applications: WB, IP
H00003004-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Granzyme M Partial Recombinant Protein (H00003004-Q01) (0)

There are no publications for Granzyme M Partial Recombinant Protein (H00003004-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme M Partial Recombinant Protein (H00003004-Q01) (0)

There are no reviews for Granzyme M Partial Recombinant Protein (H00003004-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granzyme M Partial Recombinant Protein (H00003004-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Granzyme M Products

Bioinformatics Tool for Granzyme M Partial Recombinant Protein (H00003004-Q01)

Discover related pathways, diseases and genes to Granzyme M Partial Recombinant Protein (H00003004-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme M Partial Recombinant Protein (H00003004-Q01)

Discover more about diseases related to Granzyme M Partial Recombinant Protein (H00003004-Q01).
 

Pathways for Granzyme M Partial Recombinant Protein (H00003004-Q01)

View related products by pathway.

PTMs for Granzyme M Partial Recombinant Protein (H00003004-Q01)

Learn more about PTMs related to Granzyme M Partial Recombinant Protein (H00003004-Q01).
 

Research Areas for Granzyme M Partial Recombinant Protein (H00003004-Q01)

Find related products by research area.

Blogs on Granzyme M

There are no specific blogs for Granzyme M, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Granzyme M Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GZMM