We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Granzyme K Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Granzyme K Peptides and Proteins

Order Details


    • Catalog Number
      H00003003-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Granzyme K Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-264 of Human GZMK full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
GZMK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
55.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Granzyme K Protein

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • Fragmentin-3
  • Granzyme 3
  • granzyme K (granzyme 3; tryptase II)
  • granzyme K (serine protease, granzyme 3; tryptase II)
  • Granzyme K
  • Granzyme-3
  • Granzyme-K
  • GZMK
  • NK-Tryp-2
  • NK-Tryptase-2
  • PRSS
  • TRYP2
  • TRYP2granzyme-3
  • Tryptase II

Background

This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2905
Species: Hu
Applications: ELISA, ICC, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP2-26444
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, mIF, WB
202-IL
Species: Hu
Applications: BA
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-62583
Species: Hu
Applications: WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
NBP3-41307
Species: Bv, Hu
Applications: Flow, ICC/IF, IHC, WB
NB100-74635
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: ICC/IF, IF, IHC,  IHC-P, MI, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for Granzyme K Recombinant Protein (H00003003-P01) (0)

There are no publications for Granzyme K Recombinant Protein (H00003003-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme K Recombinant Protein (H00003003-P01) (0)

There are no reviews for Granzyme K Recombinant Protein (H00003003-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granzyme K Recombinant Protein (H00003003-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Granzyme K Products

Blogs on Granzyme K

There are no specific blogs for Granzyme K, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Granzyme K Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GZMK