GPR98 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GPR98 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GPR98 Antibody - BSA Free
Background
GPR98, also known as Very Large G Protein-Coupled Receptor-1 (VLGR1), is an Orphan-A GPCR with an unknown ligand. VLGR1 consists of three expressed isoforms. VLGR1 has a large ectodomain containing multiple CALX-beta repeats that resemble regulatory domains of sodium-calcium exchanger proteins. VLGR1b, which is the only form expressed in mouse, is apparently the largest known cell-surface protein with an ectodomain containing 35 CALX- repeats and a pentraxin homology domain. The MASS1 gene, which is a fragment of the very large G-protein-coupled receptor VLGR1, is mutated in the Frings mouse model of audiogenic epilepsy. VLGR1 has been reported to be widely expressed in normal solid tissues. ESTs have been isolated from human adrenal, brain, colon, eye, kidney, nerve, and testis libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC-P
Species: Hu
Applications: Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for GPR98 Antibody (NBP2-57048) (0)
There are no publications for GPR98 Antibody (NBP2-57048).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR98 Antibody (NBP2-57048) (0)
There are no reviews for GPR98 Antibody (NBP2-57048).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GPR98 Antibody (NBP2-57048) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR98 Products
Research Areas for GPR98 Antibody (NBP2-57048)
Find related products by research area.
|
Blogs on GPR98