Home » GPR89 » GPR89 Antibodies » GPR89 Antibody (4D8)

GPR89 Antibody (4D8)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: GPR89 Antibody (4D8) [H00051463-M01] - Detection limit for recombinant GST tagged GPR89 is approximately 1ng/ml as a capture antibody.
Sandwich ELISA: GPR89 Antibody (4D8) [H00051463-M01] - Detection limit for recombinant GST tagged GPR89 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
4D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

GPR89 Antibody (4D8) Summary

Immunogen
GPR89 (AAH03187, 175 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK
Specificity
GPR89 - G protein-coupled receptor 89
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GPR89B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPR89 Antibody (4D8)

  • FLJ55546
  • G protein-coupled receptor 89
  • G protein-coupled receptor 89B
  • Golgi pH regulator A
  • Golgi pH regulator B
  • GPHR
  • GPHRB
  • GPR89
  • protein GPR89
  • Protein GPR89B
  • putative MAPK-activating protein PM01
  • putative NF-kappa-B-activating protein 90
  • SH120

Background

The Golgi pH regulator (A or B) protein encoded by the GPR89 gene functions as a voltage dependent anion channel. The GPR89 gene and coded proteins are necessary for acidification and works of the Golgi apparatus in counter-ion conductance. Three isoforms encoded by the GPR89 gene exist: Isoform 1 is 455 amino acids long, nearly 53 kDA; isoform 2 is 335 amino acids in length at 38 kDA; and isoform 3 exists at 430 amino acids and just under 50 kDA. GPR89 interacts with the CLN3 as well as UBC genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-30475] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 (NBP1-30475). Detection: DAB
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Formaldehyde-fixed asynchronous HeLa cells. Antibody: Affinity purified rabbit anti- BRD2 used at a dilution of 1:100 (2 ug/mL) (left) and rabbit anti-BRD2 recombinant monoclonal used at a dilution of 1:20 (right). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.
Immunoprecipitation: BRD2 Antibody [NBP1-30475] - Detection of human BRD2 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-BRD2 antibody NBP1-30475 used for IP at 6 ug per reaction. BRD2 was also immunoprecipitated by rabbit anti-BRD2 antibody NBP1-30474 and rabbit anti-BRD2 recombinant monoclonal antibody [BL-167-2A2] (NBP2-76410). For blotting immunoprecipitated BRD2, NBP2-76410 was used at 1:1000. Detection: Chemiluminescence with an exposure time time of 3 minutes.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
FSHR Antibody
(6E8.2F5) - BSA Free
NBP2-36489
Immunohistochemistry-Paraffin: FSH R Antibody (6E8.2F5) [NBP2-36489] - IHC analysis of formalin-fixed paraffin-embedded tissue section of human kidney using FSH R antibody (clone 6E8.2F5) at 5 ug/ml concentration.
Immunohistochemistry-Paraffin: FSH R Antibody (6E8.2F5) [NBP2-36489] - IHC analysis of formalin-fixed paraffin-embedded tissue section of human placenta using FSH R antibody (clone 6E8.2F5) at 5 ug/ml concentration.
Immunohistochemistry-Paraffin: FSH R Antibody (6E8.2F5) [NBP2-36489] - IHC analysis of formalin-fixed paraffin-embedded tissue section of human rectal adenocarcinoma using FSH R antibody (clone 6E8.2F5) at 5 ug/ml concentration. The columnar cells depicted strong membranous staining with weaker cytoplasmic signal for FSHR protein.
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
DSS1 Antibody
NBP1-91148
Immunohistochemistry-Paraffin: DSS1 Antibody [NBP1-91148] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
TSHR Antibody
(484405) [Unconjugate
MAB6534
Western blot shows lysates of human thyroid tissue. PVDF Membrane was probed with 2 µg/mL of Mouse Anti-Human TSH R Monoclonal Antibody (Catalog # MAB6534) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for TSH R at approximately 55 and 83 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 7.
Recombinant human TSH R protein was serially diluted 2-fold and captured by Mouse Anti-Human TSH R Monoclonal Antibody (Catalog # MAB65341) coated on a Clear Polystyrene Microplate (Catalog # DY990). Mouse Anti-Human TSH R Monoclonal Antibody (Catalog # MAB6534) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Species: Hu
Applications: ELISA, WB
GCR2 Antibody
NBP2-33278
Immunocytochemistry/Immunofluorescence: GCR2 Antibody [NBP2-33278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: GCR2 Antibody [NBP2-33278] - Staining of human endometrium shows weak to moderate nuclear positivity in stromal cells.
Immunohistochemistry-Paraffin: GCR2 Antibody [NBP2-33278] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

CAMP/LL37/FALL39/Cathe ...
NBP1-76864
Immunohistochemistry-Paraffin: CAMP/LL37/FALL39/Cathelicidin Antibody [NBP1-76864] - IHC analysis of a formalin fixed paraffin embedded tissue section of human lymph node using 5 ug/ml dilution of CAMP antibody (NBP1-76864). The signal was developed using HRP-DAB method which followed counterstaining of the cells with hematoxylin.
Western Blot: CAMP/LL37/FALL39/Cathelicidin Antibody [NBP1-76864] - Human spleen tissue lysate with Cathelicidin antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: CAMP/LL37/FALL39/Cathelicidin Antibody [NBP1-76864] - in Human Spleen cells.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Lgr6 Antibody
(918719) [Unconjugate
MAB8458
HEK293 human embryonic kidney cell line transfected with human Lgr6 and eGFP was stained with either (A) Mouse Anti-Human Lgr6 Monoclonal Antibody (Catalog # MAB8458) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B).
Lgr6 was detected in immersion fixed HEK293 human embryonic kidney cell line transfected with human Lgr6 and eGFP (green) using Mouse Anti-Human Lgr6 Monoclonal Antibody (Catalog # MAB8458) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC
CXCL8/IL-8
Antibody (6217) [Unco ...
MAB208
Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.
IL-8/CXCL8 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(107 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - SC65 directly interacts with lysyl-hydroxylase 1 (LH1). Western blot of primary calvarial osteoblast and skin fibroblast lysates from WT and Sc65KO 3 day-old mice (N = 2) showing significantly decreased levels of LH1 protein in Sc65KO samples. Densitometric quantification of LH1 protein normalized to beta-actin from the western blot shown above (*p<0.05; error bars represent SD). All experiments were performed at least 3 times. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pgen.1006002), licensed under a CC-BY licence.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-251 MG and human cell line RT-4.
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis in human cell line U-87 MG.
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
GPR151 Antibody -
BSA Free
NLS418
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with brain, thalamus at 2 ug/ ml.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with human brain, glioblastoma.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Anti-GPR151 antibody IHC of human Lung, Non-Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu
Applications: IHC, IHC-P
Frizzled-4
Antibody (145901)
MAB194
Frizzled-4 Antibody (145901)
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Gephyrin/GPHN
Antibody (OTI3B6)
NBP2-03449
Flow Cytometry: Gephyrin/GPHN Antibody (3B6) [NBP2-03449] - Analysis of Jurkat cells, using anti-Gephyrin antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Gephyrin/GPHN Antibody (3B6) [NBP2-03449] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Gephyrin antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: Gephyrin/GPHN Antibody (3B6) [NBP2-03449] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Gephyrin.
(1 Review)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Kallikrein
6/Neurosin Antibody
AF2008
Kallikrein 6/Neurosin was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 15 µg/mL Goat Anti-Human Kallikrein 6/Neurosin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2008) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IP, WB
Kallikrein 7
Antibody [Unconjugate
AF2624
Western blot shows lysates of human skin tissue and mouse skin tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Kallikrein 7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2624) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Kallikrein 7 at approximately 27-30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Kallikrein 7 was detected in immersion fixed paraffin-embedded sections of human skin using 1.7 µg/mL Goat Anti-Human Kallikrein 7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2624) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(6 Publications)
Species: Hu, Mu
Applications: IHC, IP, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen: Rhodopsin Antibody (4D2) [NBP2-59690] - Zebrafish retina (outer nuclear layer). PFA and methanol fixed 7 um sections. Rhodopsin antibody O/N incubation at 1:500. IHC-Fr image submitted by a verified customer review.
Western Blot: Rhodopsin Antibody (4D2) [NBP2-59690] - Western Blot analysis of Bovine photoreceptor membranes showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 4D2 (NBP2-59690). Lane 1: MW ladder. Lane 2: 10 ug. Lane 3: 5 ug. Lane 4: 2.5 ug.. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody (NBP2-59690) at 1:1000.
Immunohistochemistry: Rhodopsin Antibody (4D2) [NBP2-59690] - Immunohistochemistry analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 4D2 (NBP2-59690). Tissue: retina. Species: Mouse. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody (NBP2-59690) at 1:1000. Secondary Antibody: FITC Goat Anti-Mouse (green). Counterstain: DAPI (blue) nuclear stain. Localization: Staining of photoreceptor outer segment (OS). Other layers of the retina: IS inner segment; ONL outer nuclear layer; OPL outer plexiform layer; INL inner nuclear layer; IPL inner plexiform layer; GCL ganglion cell layer..
(1 Review)
(3 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
LHR Antibody - BSA
Free
NLS1436
Immunohistochemistry-Paraffin: LHR Antibody [NLS1436] - Ovary, Graafian Follicle
Immunohistochemistry-Paraffin: LHR Antibody [NLS1436] - Placenta
Immunohistochemistry-Paraffin: LHR Antibody [NLS1436] - Colon Myenteric Plexus
(1 Review)
(5 Publications)
Species: Bv, Ca, Hu
Applications: IHC, IHC-P

Publications for GPR89 Antibody (H00051463-M01) (0)

There are no publications for GPR89 Antibody (H00051463-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR89 Antibody (H00051463-M01) (0)

There are no reviews for GPR89 Antibody (H00051463-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR89 Antibody (H00051463-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR89 Products

Bioinformatics Tool for GPR89 Antibody (H00051463-M01)

Discover related pathways, diseases and genes to GPR89 Antibody (H00051463-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for GPR89 Antibody (H00051463-M01)

Find related products by research area.

Blogs on GPR89

There are no specific blogs for GPR89, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR89 Antibody (4D8) and receive a gift card or discount.


Bioinformatics

Gene Symbol GPR89B
Entrez
Uniprot