GPR89 Antibody (4D8) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse GPR89 Antibody (4D8) - Azide and BSA Free (H00051463-M01) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
GPR89 (AAH03187, 175 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK |
| Specificity |
GPR89 - G protein-coupled receptor 89 |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
GPR89B |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GPR89 Antibody (4D8) - Azide and BSA Free
Background
The Golgi pH regulator (A or B) protein encoded by the GPR89 gene functions as a voltage dependent anion channel. The GPR89 gene and coded proteins are necessary for acidification and works of the Golgi apparatus in counter-ion conductance. Three isoforms encoded by the GPR89 gene exist: Isoform 1 is 455 amino acids long, nearly 53 kDA; isoform 2 is 335 amino acids in length at 38 kDA; and isoform 3 exists at 430 amino acids and just under 50 kDA. GPR89 interacts with the CLN3 as well as UBC genes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Pm-Cm, Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Ca, Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Publications for GPR89 Antibody (H00051463-M01) (0)
There are no publications for GPR89 Antibody (H00051463-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR89 Antibody (H00051463-M01) (0)
There are no reviews for GPR89 Antibody (H00051463-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GPR89 Antibody (H00051463-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR89 Products
Research Areas for GPR89 Antibody (H00051463-M01)
Find related products by research area.
|
Blogs on GPR89