GPR89 Antibody (4D8)

Images

 
Sandwich ELISA: GPR89 Antibody (4D8) [H00051463-M01] - Detection limit for recombinant GST tagged GPR89 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
4D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GPR89 Antibody (4D8) Summary

Immunogen
GPR89 (AAH03187, 175 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK
Specificity
GPR89 - G protein-coupled receptor 89
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GPR89B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GPR89 Antibody (4D8)

  • FLJ55546
  • G protein-coupled receptor 89
  • G protein-coupled receptor 89B
  • Golgi pH regulator A
  • Golgi pH regulator B
  • GPHR
  • GPHRB
  • GPR89
  • protein GPR89
  • Protein GPR89B
  • putative MAPK-activating protein PM01
  • putative NF-kappa-B-activating protein 90
  • SH120

Background

The Golgi pH regulator (A or B) protein encoded by the GPR89 gene functions as a voltage dependent anion channel. The GPR89 gene and coded proteins are necessary for acidification and works of the Golgi apparatus in counter-ion conductance. Three isoforms encoded by the GPR89 gene exist: Isoform 1 is 455 amino acids long, nearly 53 kDA; isoform 2 is 335 amino acids in length at 38 kDA; and isoform 3 exists at 430 amino acids and just under 50 kDA. GPR89 interacts with the CLN3 as well as UBC genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-36489
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-91148
Species: Hu
Applications: IHC, IHC-P
MAB6534
Species: Hu
Applications: ELISA, WB
NBP2-33278
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76864
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-03449
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2008
Species: Hu
Applications: IHC, IP, WB
AF2624
Species: Hu, Mu
Applications: IHC, IP, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NLS1436
Species: Bv, Ca, Hu
Applications: IHC, IHC-P

Publications for GPR89 Antibody (H00051463-M01) (0)

There are no publications for GPR89 Antibody (H00051463-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR89 Antibody (H00051463-M01) (0)

There are no reviews for GPR89 Antibody (H00051463-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR89 Antibody (H00051463-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR89 Products

Bioinformatics Tool for GPR89 Antibody (H00051463-M01)

Discover related pathways, diseases and genes to GPR89 Antibody (H00051463-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for GPR89 Antibody (H00051463-M01)

Find related products by research area.

Blogs on GPR89

There are no specific blogs for GPR89, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR89 Antibody (4D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR89B
Entrez
Uniprot