GPR150 Recombinant Protein Antigen

Images

 
There are currently no images for GPR150 Protein (NBP1-87287PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPR150 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR150.

Source: E.coli

Amino Acid Sequence: GDCRLRRQLRKRLGSLCCAPQGGAEDEEGPRGHQALYRQRWPHPHYHHARREPLDEGGLRPPPPRPRPLPCSCESAF

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPR150
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87287.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GPR150 Recombinant Protein Antigen

  • G protein-coupled receptor 150
  • GPR150
  • PGR11
  • probable G-protein coupled receptor 150
  • seven transmembrane helix receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59008
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84545
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4076
Species: Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP2-55699
Species: Hu
Applications: WB, ICC/IF
NBP2-33740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NLS2032
Species: Hu, Mu, Rt, Po, Bv, Ca, Ha, Mk, Rb
Applications: IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-83261
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
NLS2717
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Ch, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP1-44315
Species: Hu, Mu, Rt, Ha, Mk
Applications: IHC-P
NBP1-87284
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-02659
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87287PEP
Species: Hu
Applications: AC

Publications for GPR150 Protein (NBP1-87287PEP) (0)

There are no publications for GPR150 Protein (NBP1-87287PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR150 Protein (NBP1-87287PEP) (0)

There are no reviews for GPR150 Protein (NBP1-87287PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GPR150 Protein (NBP1-87287PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GPR150 Protein (NBP1-87287PEP)

Discover related pathways, diseases and genes to GPR150 Protein (NBP1-87287PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR150 Protein (NBP1-87287PEP)

Discover more about diseases related to GPR150 Protein (NBP1-87287PEP).
 

Pathways for GPR150 Protein (NBP1-87287PEP)

View related products by pathway.

PTMs for GPR150 Protein (NBP1-87287PEP)

Learn more about PTMs related to GPR150 Protein (NBP1-87287PEP).

Blogs on GPR150

There are no specific blogs for GPR150, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
GPR150 Antibody
NBP1-87287

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPR150 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR150
Entrez