GPR12 Antibody - BSA Free

Western Blot: GPR12 Antibody [NBP3-09437] - Western blot analysis of GPR12 in Fetal Liver as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR12 Antibody - BSA Free (NBP3-09437) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR12 (NP_005279). Peptide sequence SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR12 Antibody - BSA Free

• FLJ18149
• FLJ97704
• G protein-coupled receptor 12
• GPCR12
• GPCR21
• GPR12
• G-protein coupled receptor 12
• MGC138349
• MGC138351

Background

GPCR GPR12 is a G protein coupled receptor. A variety of extracellular signals are transmitted into cells through integral membrane receptors coupled to heterotrimeric G proteins. Such G protein coupled receptors are critical for the normal functions of many cell types: neurons, endocrine cells, cardiac and smooth muscle cells, and sensory cells for detection of light, taste, and smell. Both activating and loss of function mutations in G protein coupled receptors have been found as the cause of human diseases. The GPR12 gene is located on human chromosome 13q12. GPR12 expression has been reported primarily in the central nervous system. Rat transcripts have been identified at low levels in testis and pituitary gland. ESTs have been isolated from human brain and eye libraries, as well as mouse brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR12