GPR114 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GPR114 Antibody [NBP1-87285] - Staining of human cell line CACO-2 shows localization to nucleoplasm, nuclear membrane & vesicles.
Immunohistochemistry-Paraffin: GPR114 Antibody [NBP1-87285] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR114 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFKDENNSSLLNNYVLGAQLSHGHVNNLRD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR114
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GPR114 Protein (NBP1-87285PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR114 Antibody

  • G protein-coupled receptor 114
  • G protein-coupled receptor PGR27
  • GPR114
  • G-protein coupled receptor PGR27
  • PGR27
  • PGR27G-protein coupled receptor 114
  • probable G-protein coupled receptor 114

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4634
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-80918
Species: Hu
Applications: IHC, IHC-P
AF5437
Species: Hu
Applications: WB
NLS1513
Species: Hu
Applications: IHC-P
NBP1-89700
Species: Hu
Applications: IHC, IHC-P
AF6494
Species: Hu
Applications: WB
NBP1-83262
Species: Hu
Applications: IHC, IHC-P
NBP2-05207
Species: Hu
NBP1-82890
Species: Hu
Applications: IHC, IHC-P
AF4894
Species: Hu
Applications: WB, Neut
AF7977
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB8496
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-03561
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-85609
Species: Hu
Applications: IHC, IHC-P
NLS1138
Species: Hu, Mu, Rt, Bt, Ch, Eq, Mk, Pm, Rb
Applications: IHC, IHC-P
H00347088-R02
Species: Hu

Publications for GPR114 Antibody (NBP1-87285) (0)

There are no publications for GPR114 Antibody (NBP1-87285).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR114 Antibody (NBP1-87285) (0)

There are no reviews for GPR114 Antibody (NBP1-87285). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GPR114 Antibody (NBP1-87285) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR114 Products

Bioinformatics Tool for GPR114 Antibody (NBP1-87285)

Discover related pathways, diseases and genes to GPR114 Antibody (NBP1-87285). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR114 Antibody (NBP1-87285)

Discover more about diseases related to GPR114 Antibody (NBP1-87285).
 

Pathways for GPR114 Antibody (NBP1-87285)

View related products by pathway.

Blogs on GPR114

There are no specific blogs for GPR114, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR114 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR114
Entrez