GNG2 Antibody (4C8) - Azide and BSA Free

Western Blot: GNG2 Antibody (4C8) [H00054331-M03] - Analysis of GNG2 expression in transfected 293T cell line by GNG2 monoclonal antibody (M03), clone 4C8. Lane 1: GNG2 transfected lysatE (7.9 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4C8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GNG2 Antibody (4C8) - Azide and BSA Free Summary

• Immunogen: GNG2 (AAH20774, 1 a.a. ~ 71 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
• Specificity: GNG2 - guanine nucleotide binding protein (G protein), gamma 2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GNG2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GNG2 Antibody (4C8) - Azide and BSA Free

• G gamma-I
• guanine nucleotide binding protein (G protein), gamma 2
• guanine nucleotide binding protein gamma 2
• guanine nucleotide-binding protein G(I)/G(O) gamma-2 subunit
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

Background

Heterotrimeric G proteins play vital roles in cellular responses to external signals. The specificity of a G protein-receptor interaction is primarily mediated by the gamma subunit.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG2
• Entrez:
  • 54331(Human)
• OMIM:
  • 606981(Human)
• Uniprot:
  • AAH20774(Human)