Recombinant Human GNG10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GNG10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-68 of Human GNG10 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL

Protein/Peptide Type
Recombinant Protein
Gene
GNG10

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GNG10 Protein

  • GNGT10
  • guanine nucleotide binding protein (G protein), gamma 10
  • guanine nucleotide binding protein 10
  • guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88111
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90592
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06661
Species: Hu
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-92532
Species: Hu
Applications: WB, IHC, IHC-P
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5269
Species: Hu, Mu
Applications: WB, IHC
NBP1-83215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011065-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31985
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85455
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5979
Species: Hu
Applications: WB, IP
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB381
Species: Hu
Applications: WB, Flow, CyTOF-ready

Publications for GNG10 Recombinant Protein (H00002790-P01) (0)

There are no publications for GNG10 Recombinant Protein (H00002790-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNG10 Recombinant Protein (H00002790-P01) (0)

There are no reviews for GNG10 Recombinant Protein (H00002790-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNG10 Recombinant Protein (H00002790-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNG10 Products

GNG10 H00002790-P01

Bioinformatics Tool for GNG10 Recombinant Protein (H00002790-P01)

Discover related pathways, diseases and genes to GNG10 Recombinant Protein (H00002790-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNG10 Recombinant Protein (H00002790-P01)

Discover more about diseases related to GNG10 Recombinant Protein (H00002790-P01).
 

Pathways for GNG10 Recombinant Protein (H00002790-P01)

View related products by pathway.

PTMs for GNG10 Recombinant Protein (H00002790-P01)

Learn more about PTMs related to GNG10 Recombinant Protein (H00002790-P01).

Blogs on GNG10

There are no specific blogs for GNG10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GNG10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNG10