Recombinant Human GNB1L GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human GNB1L Protein [H00054584-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human GNB1L GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 98-207 of Human GNB1L

Source: Wheat Germ (in vitro)

Amino Acid Sequence: AEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GNB1L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GNB1L GST (N-Term) Protein

  • DGCRK3
  • G-protein beta subunit-like protein
  • guanine nucleotide binding protein (G protein), beta polypeptide 1-like
  • guanine nucleotide binding protein beta-subunit-like polypeptide
  • guanine nucleotide-binding protein subunit beta-like protein 1
  • GY2WD40 repeat-containing protein deleted in VCFS
  • KIAA1645
  • WD repeat-containing protein 14
  • WDR14G protein subunit beta-like protein 1
  • WDVCF

Background

GNB1L - guanine nucleotide binding protein (G protein), beta polypeptide 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBA1-19349
Species: Mu
Applications: Flow, ICC/IF, In vitro
AF4067
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00055835-M02
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
7268-CT
Species: Hu
Applications: BA
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04894
Species: Hu
Applications: IHC, KO, WB
NBP2-45780
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03839
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-2832
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
7754-BH/CF
Species: Hu
Applications: BA
H00054584-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for GNB1L Partial Recombinant Protein (H00054584-Q01) (0)

There are no publications for GNB1L Partial Recombinant Protein (H00054584-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNB1L Partial Recombinant Protein (H00054584-Q01) (0)

There are no reviews for GNB1L Partial Recombinant Protein (H00054584-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNB1L Partial Recombinant Protein (H00054584-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNB1L Products

Array H00054584-Q01

Bioinformatics Tool for GNB1L Partial Recombinant Protein (H00054584-Q01)

Discover related pathways, diseases and genes to GNB1L Partial Recombinant Protein (H00054584-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNB1L Partial Recombinant Protein (H00054584-Q01)

Discover more about diseases related to GNB1L Partial Recombinant Protein (H00054584-Q01).
 

Pathways for GNB1L Partial Recombinant Protein (H00054584-Q01)

View related products by pathway.

Research Areas for GNB1L Partial Recombinant Protein (H00054584-Q01)

Find related products by research area.

Blogs on GNB1L

There are no specific blogs for GNB1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GNB1L GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNB1L