GNB1L Antibody

Western Blot: GNB1L Antibody [NBP1-81787] - Analysis in control (vector only transfected HEK293T lysate) and GNB1L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: GNB1L Antibody [NBP1-81787] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Discontinued

GNB1L Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNB1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GNB1L Antibody

• DGCRK3
• G-protein beta subunit-like protein
• guanine nucleotide binding protein (G protein), beta polypeptide 1-like
• guanine nucleotide binding protein beta-subunit-like polypeptide
• guanine nucleotide-binding protein subunit beta-like protein 1
• GY2WD40 repeat-containing protein deleted in VCFS
• KIAA1645
• WD repeat-containing protein 14
• WDR14G protein subunit beta-like protein 1
• WDVCF

Background

The GNB1L gene codes a guanine nucleotide-binding protein subunit beta-like protein 1 that is a member of the WD repeat protein family. Isoform 1 is 327 amino acids long with a mass of around 35 kDA while isoform 2 exists at 212 amino acids long and nearly 23 kDA. Members of the WD repeat protein family are known for their involvement in many cellular responses such as: cycle progression, signal transduction, apoptosis, and gene regulation. The GNB1L gene can be found on chromosome 22q11, and if deleted, will cause DiGeorge syndrome. The GNB1L gene has been researched regarding its role in schizophrenia, spinal cord disease, carcinoma, cat eye syndrome, hypopharynx cancer, and visceral leishmaniasis. GNB1L gene interacts with genes KLHL12 and UBC in pathways such as the beta-agonist/beta blocker.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNB1L