Recombinant Human Glycogen phosphorylase, muscle form Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Glycogen phosphorylase, muscle form Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 734-842 of Human PYGM partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PYGM

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Glycogen phosphorylase, muscle form Protein

  • EC 2.4.1.1
  • glycogen phosphorylase, muscle form
  • myophosphorylase
  • phosphorylase, glycogen, muscle
  • phosphorylase, glycogen; muscle

Background

Glycogen phosphorylase (EC 2.4.1.1) catalyzes and regulates the breakdown of glycogen to glucose-1-phosphate.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-55090
Species: Hu
Applications: WB, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01142
Species: Hu, Mu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001376-B01P
Species: Hu
Applications: WB
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P

Publications for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01) (0)

There are no publications for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01) (0)

There are no reviews for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glycogen phosphorylase, muscle form Products

Bioinformatics Tool for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01)

Discover related pathways, diseases and genes to Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01)

Discover more about diseases related to Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01).
 

Pathways for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01)

View related products by pathway.

PTMs for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01)

Learn more about PTMs related to Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01).
 

Research Areas for Glycogen phosphorylase, muscle form Partial Recombinant Protein (H00005837-Q01)

Find related products by research area.

Blogs on Glycogen phosphorylase, muscle form

There are no specific blogs for Glycogen phosphorylase, muscle form, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Menin Antibody
NB100-215

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Glycogen phosphorylase, muscle form Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PYGM