We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Glycine Receptor Alpha 1 Recombinant Protein Antigen

Images

 
There are currently no images for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glycine Receptor Alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLRA1.

Source: E. coli

Amino Acid Sequence: LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLRA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86988.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glycine Receptor Alpha 1 Recombinant Protein Antigen

  • GLRA 1
  • GLRA1
  • Glycine receptor 48 kDa subunit
  • Glycine receptor strychnine-binding subunit
  • glycine receptor subunit alpha-1
  • glycine receptor, alpha 1 (startle disease/hyperekplexia)
  • glycine receptor, alpha 1
  • HKPX1
  • MGC138878
  • MGC138879
  • STHE

Background

Glycine is an important inhibitory neurotransmitter in the mammalian central nervous system, especially in the brainstem and spinal cord. It acts by binding to anion-conducting glycine receptors that belong to a superfamily of ligand-gated ion channels. Glycine receptors were first purified as strychnine binding sites in membrane fractions of adult spinal cord from rats (1). These strychnine-sensitive binding sites are different from the strychnine-insensitive binding sites found in the N-methyl-D-aspartate (NMDA) subtype of glutamate receptors. Adult glycine receptors are heterodimers composed of two subunits of 48 kDa and 58 kDa, denoted as a1 and b subunits. Fetal glycine receptors are homomers composed of a2 subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61774
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-86653
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-03449
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-52071
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7848
Species: Hu
Applications: IHC, WB
NBP3-46221
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB100-757
Species: Hu
Applications: ChIP, IHC,  IHC-P, WB
NBP3-46222
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-52149
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, MiAr, PEP-ELISA
NBP1-87466
Species: Hu
Applications: IHC,  IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-191
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB

Publications for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP) (0)

There are no publications for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP) (0)

There are no reviews for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glycine Receptor Alpha 1 Products

Research Areas for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP)

Find related products by research area.

Blogs on Glycine Receptor Alpha 1

There are no specific blogs for Glycine Receptor Alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glycine Receptor Alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRA1