Glycine Receptor Alpha 1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLRA1. Source: E. coli
Amino Acid Sequence: LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GLRA1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86988. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Glycine Receptor Alpha 1 Recombinant Protein Antigen
Background
Glycine is an important inhibitory neurotransmitter in the mammalian central nervous system, especially in the brainstem and spinal cord. It acts by binding to anion-conducting glycine receptors that belong to a superfamily of ligand-gated ion channels. Glycine receptors were first purified as strychnine binding sites in membrane fractions of adult spinal cord from rats (1). These strychnine-sensitive binding sites are different from the strychnine-insensitive binding sites found in the N-methyl-D-aspartate (NMDA) subtype of glutamate receptors. Adult glycine receptors are heterodimers composed of two subunits of 48 kDa and 58 kDa, denoted as a1 and b subunits. Fetal glycine receptors are homomers composed of a2 subunits.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
Publications for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP) (0)
There are no publications for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP) (0)
There are no reviews for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP) (0)
Additional Glycine Receptor Alpha 1 Products
Research Areas for Glycine Receptor Alpha 1 Protein (NBP1-86988PEP)
Find related products by research area.
|
Blogs on Glycine Receptor Alpha 1