Glutathione S-transferase Mu 5 Antibody

Western Blot: Glutathione S-transferase Mu 5 Antibody [H00002949-B01P] - Analysis of GSTM5 expression in transfected 293T cell line by GSTM5 polyclonal antibody. Lane 1: GSTM5 transfected lysate(25.70 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Glutathione S-transferase Mu 5 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GSTM5 (NP_000842.2, 1 a.a. - 218 a.a.) full-length human protein. MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: GSTM5
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glutathione S-transferase Mu 5 Antibody

• EC 2.5.1.18
• glutathione S-alkyltransferase M5
• glutathione S-aralkyltransferase M5
• glutathione S-aryltransferase M5
• glutathione S-transferase M5
• glutathione S-transferase mu 5
• GST class-mu 5
• GSTM5-5
• GTM5
• S-(hydroxyalkyl)glutathione lyase M5

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSTM5
• Uniprot:
  • NP_000842.2(Human)