GLB1L2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GLB1L2 Antibody [NBP2-31585] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry: GLB1L2 Antibody [NBP2-31585] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLB1L2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLB1L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLB1L2 Protein (NBP2-31585PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLB1L2 Antibody

  • beta-galactosidase-1-like protein 2
  • EC 3.2.1
  • EC 3.2.1.-
  • EC 3.2.1.23
  • galactosidase, beta 1-like 2
  • MST114
  • MSTP114

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-79431
Species: Hu
Applications: WB
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-81235
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80391
Species: Hu
Applications: WB
NBP2-29341
Species: Mu
Applications: WB, PEP-ELISA
NBP2-48716
Species: Hu
Applications: IHC
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38638
Species: Hu
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-31585
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GLB1L2 Antibody (NBP2-31585) (0)

There are no publications for GLB1L2 Antibody (NBP2-31585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLB1L2 Antibody (NBP2-31585) (0)

There are no reviews for GLB1L2 Antibody (NBP2-31585). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GLB1L2 Antibody (NBP2-31585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLB1L2 Products

Bioinformatics Tool for GLB1L2 Antibody (NBP2-31585)

Discover related pathways, diseases and genes to GLB1L2 Antibody (NBP2-31585). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLB1L2 Antibody (NBP2-31585)

Discover more about diseases related to GLB1L2 Antibody (NBP2-31585).
 

Pathways for GLB1L2 Antibody (NBP2-31585)

View related products by pathway.

Research Areas for GLB1L2 Antibody (NBP2-31585)

Find related products by research area.

Blogs on GLB1L2

There are no specific blogs for GLB1L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLB1L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLB1L2
Uniprot