GLB1L Antibody

Images

 
Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining in human testis and endometrium tissues using anti-GLB1L antibody. Corresponding GLB1L RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLB1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH
Specificity
Specificity of human GLB1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLB1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLB1L Protein (NBP1-81235PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLB1L Antibody

  • beta-galactosidase-1-like protein
  • EC 3.2.1
  • EC 3.2.1.-
  • EC 3.2.1.23
  • galactosidase, beta 1-like
  • MGC10771

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IF
NBP2-48716
Species: Hu
Applications: IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-31585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56853
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-38638
Species: Hu
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-81235
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GLB1L Antibody (NBP1-81235) (0)

There are no publications for GLB1L Antibody (NBP1-81235).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLB1L Antibody (NBP1-81235) (0)

There are no reviews for GLB1L Antibody (NBP1-81235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GLB1L Antibody (NBP1-81235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GLB1L Antibody (NBP1-81235)

Discover related pathways, diseases and genes to GLB1L Antibody (NBP1-81235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLB1L Antibody (NBP1-81235)

Discover more about diseases related to GLB1L Antibody (NBP1-81235).
 

Pathways for GLB1L Antibody (NBP1-81235)

View related products by pathway.

Research Areas for GLB1L Antibody (NBP1-81235)

Find related products by research area.

Blogs on GLB1L

There are no specific blogs for GLB1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLB1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLB1L