![Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining in human testis and endometrium tissues using anti-GLB1L antibody. Corresponding GLB1L RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GLB1L-Antibody-Immunohistochemistry-Paraffin-NBP1-81235-img0008.jpg "Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining in human testis and endometrium tissues using anti-GLB1L antibody. Corresponding GLB1L RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GLB1L |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GLB1L Antibody (NBP1-81235)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GLB1L |
![Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/GLB1L-Antibody-Immunohistochemistry-Paraffin-NBP1-81235-img0006.jpg "Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/GLB1L-Antibody-Immunohistochemistry-Paraffin-NBP1-81235-img0007.jpg "Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining of human testis shows high expression.")
![Immunohistochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD45_AF114_Immunohistochemistry_23525.jpg)
![Immunocytochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/af114_mouse-cd45-affinity-purified-polyclonal-ab-immunocytochemistry-6122021145449.jpg)
![Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]](https://images.novusbio.com/images/af114_mouse-cd45-affinity-purified-polyclonal-ab-41202410331954.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")