GLB1L Antibody - BSA Free

Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining in human testis and endometrium tissues using anti-GLB1L antibody. Corresponding GLB1L RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: GLB1L Antibody [NBP1-81235] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GLB1L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GLB1L Antibody - BSA Free (NBP1-81235) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GRYWTKQGPQQTLYVPRFLLFPRGALNKITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLB1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GLB1L Protein (NBP1-81235PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GLB1L Antibody - BSA Free

• beta-galactosidase-1-like protein
• EC 3.2.1
• EC 3.2.1.-
• EC 3.2.1.23
• galactosidase, beta 1-like
• MGC10771

Background

GLB1L, also known as Beta-galactosidase-1-like protein 3, is a member of the glycosyl hydrolase 35 family. GLB1L has a 653 amino acid long isoform that is approximately 74kDa, and two shorter isoforms that are 314 and 313 amino acids long, respectively. Current research surrounding GLB1L has shown possible interactions with diseases and disorders such as pneumonia, leber congenital amaurosis, and gangliosidosis. GLB1L has also been shown to interact with PPP1CC and ATG2A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLB1L