Recombinant Human GIT2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GIT2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 401-498 of Human GIT2

Source: Wheat Germ

Amino Acid Sequence: TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GIT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GIT2 Protein

  • ARF GAP GIT2
  • ARF GTPase-activating protein GIT2
  • CAT2
  • CAT-2
  • cool-associated, tyrosine phosphorylated protein 2
  • Cool-interacting tyrosine-phosphorylated protein 2
  • DKFZp686G01261
  • G protein-coupled receptor kinase interacting ArfGAP 2
  • G protein-coupled receptor kinase interactor 2
  • G protein-coupled receptor kinase-interactor 2
  • KIAA0148GRK-interacting protein 2
  • MGC760

Background

GIT2 - G protein-coupled receptor kinase interactor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-22423
Species: Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67427
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58924
Species: Hu
Applications: ICC/IF
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for GIT2 Partial Recombinant Protein (H00009815-Q01) (0)

There are no publications for GIT2 Partial Recombinant Protein (H00009815-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIT2 Partial Recombinant Protein (H00009815-Q01) (0)

There are no reviews for GIT2 Partial Recombinant Protein (H00009815-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GIT2 Partial Recombinant Protein (H00009815-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GIT2 Partial Recombinant Protein (H00009815-Q01)

Discover related pathways, diseases and genes to GIT2 Partial Recombinant Protein (H00009815-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIT2 Partial Recombinant Protein (H00009815-Q01)

Discover more about diseases related to GIT2 Partial Recombinant Protein (H00009815-Q01).
 

Pathways for GIT2 Partial Recombinant Protein (H00009815-Q01)

View related products by pathway.

PTMs for GIT2 Partial Recombinant Protein (H00009815-Q01)

Learn more about PTMs related to GIT2 Partial Recombinant Protein (H00009815-Q01).

Blogs on GIT2

There are no specific blogs for GIT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GIT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GIT2