Recombinant Human GIT2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GIT2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 401-498 of Human GIT2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TDLETTASKTNRQKLQTLQSENSNLRKQATTNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMRLQPFPAHA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GIT2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GIT2 Protein

  • ARF GAP GIT2
  • ARF GTPase-activating protein GIT2
  • CAT2
  • CAT-2
  • cool-associated, tyrosine phosphorylated protein 2
  • Cool-interacting tyrosine-phosphorylated protein 2
  • DKFZp686G01261
  • G protein-coupled receptor kinase interacting ArfGAP 2
  • G protein-coupled receptor kinase interactor 2
  • G protein-coupled receptor kinase-interactor 2
  • KIAA0148GRK-interacting protein 2
  • MGC760

Background

GIT2 - G protein-coupled receptor kinase interactor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-78911
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-58924
Species: Hu
Applications: ICC/IF
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GIT2 Partial Recombinant Protein (H00009815-Q01) (0)

There are no publications for GIT2 Partial Recombinant Protein (H00009815-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIT2 Partial Recombinant Protein (H00009815-Q01) (0)

There are no reviews for GIT2 Partial Recombinant Protein (H00009815-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GIT2 Partial Recombinant Protein (H00009815-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GIT2 Products

Bioinformatics Tool for GIT2 Partial Recombinant Protein (H00009815-Q01)

Discover related pathways, diseases and genes to GIT2 Partial Recombinant Protein (H00009815-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIT2 Partial Recombinant Protein (H00009815-Q01)

Discover more about diseases related to GIT2 Partial Recombinant Protein (H00009815-Q01).
 

Pathways for GIT2 Partial Recombinant Protein (H00009815-Q01)

View related products by pathway.

PTMs for GIT2 Partial Recombinant Protein (H00009815-Q01)

Learn more about PTMs related to GIT2 Partial Recombinant Protein (H00009815-Q01).

Blogs on GIT2

There are no specific blogs for GIT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GIT2 Antibody (M1)
H00009815-M03
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GIT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GIT2