![Western Blot: GIPC3 Antibody [NBP2-86652] - WB Suggested Anti-GIPC3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate](http://images.novusbio.com/fullsize/GIPC3-Antibody-Western-Blot-NBP2-86652-img0001.jpg "Western Blot: GIPC3 Antibody [NBP2-86652] - WB Suggested Anti-GIPC3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GIPC3. Peptide sequence: TLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GIPC3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Wnt-2b Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Wnt-2b Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GIPC3 |
![Immunohistochemistry Frizzled-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Frizzled-3_AF1001_Immunohistochemistry_9912.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Immunohistochemistry_6672.jpg)
![Western Blot TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Western_Blot_17300.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images/af1056_rat-trka-affinity-purified-polyclonal-ab-8220249503264.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Chromatin Immunoprecipitation (ChIP) SOX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX17_AF1924_Chromatin_Immunoprecipitation_11220.jpg)
![Simple Western SOX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX17_AF1924_Simple_Western_16675.jpg)
![Immunocytochemistry SOX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX17_AF1924_Immunocytochemistry_6477.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
