GIPC3 Antibody - BSA Free

Western Blot: GIPC3 Antibody [NBP2-86652] - WB Suggested Anti-GIPC3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GIPC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GIPC3 Antibody - BSA Free (NBP2-86652) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GIPC3. Peptide sequence: TLRLRSGGAATVEEAPSEFEEEASRKVDDLLESYMGIRDPELASTMVETS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GIPC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GIPC3 Antibody - BSA Free

• C19orf64
• chromosome 19 open reading frame 64
• DKFZp686J1198
• FLJ40925
• GIPC PDZ domain containing family, member 3
• PDZ domain protein GIPC3
• PDZ domain-containing protein GIPC3

Background

GIPC1, GIPC2, and GIPC3 are a family of central PDZ-domain proteins with GH1 and GH2 domains. GIPC3 has a 59.9% homology with GIPC1, and was found to be ubiquitously expressed in adult and fetal tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GIPC3