GIF Antibody

Images

 
Western Blot: GIF Antibody [H00002694-D01P] - Analysis of GIF expression in mouse stomach.
Western Blot: GIF Antibody [H00002694-D01P] - Analysis of GIF expression in transfected 293T cell line by GIF polyclonal antibody.Lane 1: GIF transfected lysate(45.40 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GIF Antibody Summary

Immunogen
GIF (NP_005133.2, 1 a.a. - 417 a.a.) full-length human protein. MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Specificity
GIF - gastric intrinsic factor (vitamin B synthesis),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GIF
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against tissue lysate and transfected lysate for WB. It has been used for ELISA.
Publications
Read Publication using H00002694-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GIF Antibody

  • gastric intrinsic factor (vitamin B synthesis)
  • GIF
  • IF
  • IFIntrinsic factor
  • IFMH
  • IFMHgastric intrinsic factor
  • INF
  • TCN3

Background

This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89772
Species: Hu
Applications: IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00006947-M12
Species: Hu
Applications: WB, ELISA, IHC-P, IP
8457-AS
Species: Hu
NB100-62239
Species: Hu
Applications: ELISA, IHC-P, RIA
MAB9350
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002694-D01P
Species: Hu, Mu
Applications: WB

Publications for GIF Antibody (H00002694-D01P)(1)

Reviews for GIF Antibody (H00002694-D01P) (0)

There are no reviews for GIF Antibody (H00002694-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GIF Antibody (H00002694-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GIF Products

Bioinformatics Tool for GIF Antibody (H00002694-D01P)

Discover related pathways, diseases and genes to GIF Antibody (H00002694-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIF Antibody (H00002694-D01P)

Discover more about diseases related to GIF Antibody (H00002694-D01P).
 

Pathways for GIF Antibody (H00002694-D01P)

View related products by pathway.

PTMs for GIF Antibody (H00002694-D01P)

Learn more about PTMs related to GIF Antibody (H00002694-D01P).

Blogs on GIF

There are no specific blogs for GIF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GIF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GIF
Entrez
Uniprot