GFPT2 Antibody - BSA Free

Western Blot: GFPT2 Antibody [NBP1-56688] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GFPT2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GFPT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 77 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23407165).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GFPT2 Antibody - BSA Free

• D-fructose-6-phosphate amidotransferase 2
• FLJ10380
• GFAT 2
• GFAT2EC 2.6.1.16
• glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2
• glutamine: fructose-6-phosphate aminotransferase 2
• Glutamine:fructose 6 phosphate amidotransferase 2
• glutamine-fructose-6-phosphate transaminase 2
• Hexosephosphate aminotransferase 2

Background

GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GFPT2 Antibody (NBP1-56688)(2)

Publications using NBP1-56688

• Heathcote KC, Keeley TP, Myllykoski M et Al. N-terminal cysteine acetylation and oxidation patterns may define protein stability Nat Commun 2024-06-25 [PMID: 38918375]
• Guillaumond F, Leca J, Olivares O et al. Strengthened glycolysis under hypoxia supports tumor symbiosis and hexosamine biosynthesis in pancreatic adenocarcinoma. Proc Natl Acad Sci U S A 2013-03-05 [PMID: 23407165] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: GFPT2
• Entrez:
  • 9945(Human)
• Uniprot:
  • O94808(Human)