GFPT2 Antibody

Images

 
Western Blot: GFPT2 Antibody [NBP1-56688] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GFPT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to GFPT2(glutamine-fructose-6-phosphate transaminase 2) The peptide sequence was selected from the middle region of GFPT2 (NP_005101). Peptide sequence TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GFPT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
Theoretical MW
77 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-56688 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GFPT2 Antibody

  • D-fructose-6-phosphate amidotransferase 2
  • FLJ10380
  • GFAT 2
  • GFAT2EC 2.6.1.16
  • glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 2
  • glutamine: fructose-6-phosphate aminotransferase 2
  • Glutamine:fructose 6 phosphate amidotransferase 2
  • glutamine-fructose-6-phosphate transaminase 2
  • Hexosephosphate aminotransferase 2

Background

GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-52474
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-81244
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-133
Species: Hu, Mu, Rt, Po, Av, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30524
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-48700
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-56688
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GFPT2 Antibody (NBP1-56688)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for GFPT2 Antibody (NBP1-56688) (0)

There are no reviews for GFPT2 Antibody (NBP1-56688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GFPT2 Antibody (NBP1-56688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GFPT2 Products

Bioinformatics Tool for GFPT2 Antibody (NBP1-56688)

Discover related pathways, diseases and genes to GFPT2 Antibody (NBP1-56688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFPT2 Antibody (NBP1-56688)

Discover more about diseases related to GFPT2 Antibody (NBP1-56688).
 

Pathways for GFPT2 Antibody (NBP1-56688)

View related products by pathway.

PTMs for GFPT2 Antibody (NBP1-56688)

Learn more about PTMs related to GFPT2 Antibody (NBP1-56688).
 

Research Areas for GFPT2 Antibody (NBP1-56688)

Find related products by research area.

Blogs on GFPT2

There are no specific blogs for GFPT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GFPT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GFPT2
Entrez
Uniprot