GBP3 Recombinant Protein Antigen

Images

 
There are currently no images for GBP3 Protein (NBP1-91929PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GBP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GBP3.

Source: E. coli

Amino Acid Sequence: LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GBP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91929.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GBP3 Recombinant Protein Antigen

  • DKFZp686E0974
  • DKFZp686L15228
  • FLJ10961
  • GBP-3
  • GTP-binding protein 3
  • Guanine nucleotide-binding protein 3
  • guanylate binding protein 3
  • guanylate-binding protein 3

Background

The GBP3 gene codes for a member of the germinal center kinase family that demonstrates antiviral activity against influenza. One isoform is 595 amino acids long at 68 kDa and the other exists at 544 amino acids in length at nearly 62 kDA. The GBP3 gene has been studied in hypoglycemic comas, hepatitis B, and influenza and interacts in pathways of interferon gamma signaling, cytokine signaling in the immune system, and expression of IFNG-stimulated genes. It interacts with genes MAP4K4, NFATC2, and FAM107B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03972
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP3-16858
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-83387
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-47768
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-72343
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, WB
H00009448-M07
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-35697
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
UL-553
Species: Hu
Applications: EnzAct
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00051062-M03
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB

Publications for GBP3 Protein (NBP1-91929PEP) (0)

There are no publications for GBP3 Protein (NBP1-91929PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBP3 Protein (NBP1-91929PEP) (0)

There are no reviews for GBP3 Protein (NBP1-91929PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GBP3 Protein (NBP1-91929PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GBP3 Products

Array NBP1-91929PEP

Blogs on GBP3

There are no specific blogs for GBP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GBP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GBP3