Recombinant Human GBGT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GBGT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 248-347 of Human GBGT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GBGT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GBGT1 Protein

  • A3GALNT
  • EC 2.4.1.-
  • Forssman glycolipid synthase-like protein
  • Forssman glycolipid synthetase (FS)
  • Forssman synthetase
  • FSUNQ2513
  • globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
  • MGC44848
  • UDP-GalNAc

Background

GBGT1 - globoside alpha-1,3-N-acetylgalactosaminyltransferase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2009
Species: Hu
Applications: WB, IHC
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF7895
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for GBGT1 Partial Recombinant Protein (H00026301-Q01) (0)

There are no publications for GBGT1 Partial Recombinant Protein (H00026301-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBGT1 Partial Recombinant Protein (H00026301-Q01) (0)

There are no reviews for GBGT1 Partial Recombinant Protein (H00026301-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GBGT1 Partial Recombinant Protein (H00026301-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GBGT1 Products

GBGT1 H00026301-Q01

Bioinformatics Tool for GBGT1 Partial Recombinant Protein (H00026301-Q01)

Discover related pathways, diseases and genes to GBGT1 Partial Recombinant Protein (H00026301-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBGT1 Partial Recombinant Protein (H00026301-Q01)

Discover more about diseases related to GBGT1 Partial Recombinant Protein (H00026301-Q01).
 

Pathways for GBGT1 Partial Recombinant Protein (H00026301-Q01)

View related products by pathway.

PTMs for GBGT1 Partial Recombinant Protein (H00026301-Q01)

Learn more about PTMs related to GBGT1 Partial Recombinant Protein (H00026301-Q01).

Blogs on GBGT1

There are no specific blogs for GBGT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GBGT1 Antibody
NBP2-14040

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GBGT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GBGT1