Galectin-8 Antibody

Images

 
Western Blot: Galectin-8 Antibody [H00003964-B01P] - Analysis of LGALS8 expression in transfected 293T cell line by LGALS8 polyclonal antibody. Lane 1: LGALS8 transfected lysate(34.87 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Galectin-8 Antibody Summary

Immunogen
LGALS8 (NP_963837.1, 1 a.a. - 317 a.a.) full-length human protein. MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LGALS8
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Galectin-8 Antibody

  • GAL8
  • Gal-8
  • galectin 8
  • Galectin8
  • Galectin-8
  • galectin-8g
  • lectin, galactoside-binding, soluble, 8
  • LGALS8
  • PCTA1
  • PCTA-1Po66 carbohydrate-binding protein
  • Po66 carbohydrate binding protein
  • Po66-CBP
  • Prostate carcinoma tumor antigen 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF2045
Species: Hu
Applications: WB, IHC, ICC
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1339
Species: Hu
Applications: WB, Simple Western, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003964-B01P
Species: Hu
Applications: WB

Publications for Galectin-8 Antibody (H00003964-B01P) (0)

There are no publications for Galectin-8 Antibody (H00003964-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-8 Antibody (H00003964-B01P) (0)

There are no reviews for Galectin-8 Antibody (H00003964-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Galectin-8 Antibody (H00003964-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Galectin-8 Products

Bioinformatics Tool for Galectin-8 Antibody (H00003964-B01P)

Discover related pathways, diseases and genes to Galectin-8 Antibody (H00003964-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galectin-8 Antibody (H00003964-B01P)

Discover more about diseases related to Galectin-8 Antibody (H00003964-B01P).
 

Pathways for Galectin-8 Antibody (H00003964-B01P)

View related products by pathway.

PTMs for Galectin-8 Antibody (H00003964-B01P)

Learn more about PTMs related to Galectin-8 Antibody (H00003964-B01P).

Blogs on Galectin-8

There are no specific blogs for Galectin-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Galectin-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LGALS8
Entrez
Uniprot