G6PC3 Antibody - Azide and BSA Free

Western Blot: G6PC3 Antibody [NBP3-03956] - Analysis of extracts of 293T cells, using G6PC3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of U2OS cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Western Blot: G6PC3 Antibody [NBP3-03956] - Analysis of extracts of various cell lines, using G6PC3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of A-549 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of C6 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: G6PC3 Antibody [NBP3-03956] - Immunofluorescence analysis of NIH/3T3 cells using G6PC3 Rabbit pAb (NBP3-03956) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Product Discontinued

G6PC3 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 4-103 of human G6PC3 (NP_612396.1). TLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWISLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: G6PC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for G6PC3 Antibody - Azide and BSA Free

• EC 3.1.3.9
• G6Pase 3
• G-6-Pase 3
• G6Pase-beta
• glucose 6 phosphatase, catalytic, 3
• glucose-6-phosphatase 3
• Glucose-6-phosphatase beta
• glucose-6-phosphatase catalytic subunit 3
• Ubiquitous glucose-6-phosphatase catalytic subunit-related protein
• ubiquitously expressed G6Pase catalytic subunit-related protein
• UGRPSCN4

Background

Glucose-6-phosphatase (G6Pase) is located in the endoplasmic reticulum (ER) and catalyzes hydrolysis of G6P to glucose and phosphate, the last step of the gluconeogenic and glycogenolytic pathways. G6PC3 is a ubiquitously expressed G6Pase catalytic subunit (Martin et al., 2002 [PubMed 12370122]; Guionie et al., 2003 [PubMed 12965222]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: G6PC3