G gamma7 Antibody (1C11-1B3)

Sandwich ELISA: G gamma7 Antibody (1C11-1B3) [H00002788-M01] - Detection limit for recombinant GST tagged GNG7 is approximately 1ng/ml as a capture antibody.

Product Discontinued

G gamma7 Antibody (1C11-1B3) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GNG7 (AAH14466, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GNG7
• Purity: Ascites

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA 1:100 - 1:2000
  • Western Blot 1:100 - 1:2000

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Ascites

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for G gamma7 Antibody (1C11-1B3)

• FLJ00058
• GNGT7
• guanine nucleotide binding protein (G protein), gamma 7
• guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7

Background

GNG7( AAH14466, 1 a.a. - 69 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GNG7