Recombinant Human FZR1/CDH1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FZR1/CDH1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-101 of Human FZR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FZR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FZR1/CDH1 Protein

  • CDC20C
  • CDH1
  • Cdh1/Hct1 homolog
  • CDH1CDC20-like 1b
  • fizzy/cell division cycle 20 related 1 (Drosophila)
  • Fzr
  • FZR2
  • FZRCDC20-like protein 1
  • hCDH1
  • HCDHFYR
  • KIAA1242fizzy-related protein homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-56552
Species: Hu
Applications: WB
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00051343-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01) (0)

There are no publications for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01) (0)

There are no reviews for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FZR1/CDH1 Products

Bioinformatics Tool for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01)

Discover related pathways, diseases and genes to FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01)

Discover more about diseases related to FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01).
 

Pathways for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01)

View related products by pathway.

PTMs for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01)

Learn more about PTMs related to FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01).
 

Research Areas for FZR1/CDH1 Partial Recombinant Protein (H00051343-Q01)

Find related products by research area.

Blogs on FZR1/CDH1

There are no specific blogs for FZR1/CDH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FZR1/CDH1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FZR1