FXR1 Antibody (2G11)

Images

 
Western Blot: FXR1 Antibody (2G11) [H00008087-M01] - Analysis of FXR1 expression in transfected 293T cell line by FXR1 monoclonal antibody (M01), clone 2G11.Lane 1: FXR1 transfected lysate(61 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: FXR1 Antibody (2G11) [H00008087-M01] - Analysis of monoclonal antibody to FXR1 on formalin-fixed paraffin-embedded human colon adenocarcinoma. Antibody concentration 3 ug/ml.
Sandwich ELISA: FXR1 Antibody (2G11) [H00008087-M01] - Detection limit for recombinant GST tagged FXR1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FXR1 Antibody (2G11) Summary

Immunogen
FXR1 (AAH28983, 121 a.a. - 220 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFH
Specificity
FXR1 - fragile X mental retardation, autosomal homolog 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FXR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FXR1 Antibody (2G11)

  • fragile X mental retardation syndrome-related protein 1
  • fragile X mental retardation, autosomal homolog 1
  • FXR1P
  • hFXR1p

Background

The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-259
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55795
Species: Hu
Applications: ICC/IF
NB400-153
Species: Hu
Applications: WB, ICC/IF
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-19607
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
H00008087-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for FXR1 Antibody (H00008087-M01) (0)

There are no publications for FXR1 Antibody (H00008087-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXR1 Antibody (H00008087-M01) (0)

There are no reviews for FXR1 Antibody (H00008087-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FXR1 Antibody (H00008087-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FXR1 Products

Bioinformatics Tool for FXR1 Antibody (H00008087-M01)

Discover related pathways, diseases and genes to FXR1 Antibody (H00008087-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXR1 Antibody (H00008087-M01)

Discover more about diseases related to FXR1 Antibody (H00008087-M01).
 

Pathways for FXR1 Antibody (H00008087-M01)

View related products by pathway.

PTMs for FXR1 Antibody (H00008087-M01)

Learn more about PTMs related to FXR1 Antibody (H00008087-M01).
 

Research Areas for FXR1 Antibody (H00008087-M01)

Find related products by research area.

Blogs on FXR1

There are no specific blogs for FXR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FXR1 Antibody (2G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol FXR1
Entrez
OMIM
Uniprot