FUT6 Antibody


Western Blot: FUT6 Antibody [NBP1-57936] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FUT6 Antibody Summary

Synthetic peptides corresponding to FUT6(fucosyltransferase 6 (alpha (1,3) fucosyltransferase)) The peptide sequence was selected from the C terminal of FUT6. Peptide sequence YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FUT6 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FUT6 Antibody

  • alpha-(1,3)-fucosyltransferase
  • EC 2.4.1
  • FCT3A
  • FCT3AFuc-TVI
  • FLJ40754
  • FT1A
  • fucosyltransferase 6 (alpha (1,3) fucosyltransferase)
  • Fucosyltransferase 6
  • Fucosyltransferase VI
  • Fuc-TVI
  • FucT-VIEC
  • FUT6
  • Galactoside 3-L-Fucosyltransferase


FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FUT6 Antibody (NBP1-57936) (0)

There are no publications for FUT6 Antibody (NBP1-57936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUT6 Antibody (NBP1-57936) (0)

There are no reviews for FUT6 Antibody (NBP1-57936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FUT6 Antibody (NBP1-57936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FUT6 Products

Bioinformatics Tool for FUT6 Antibody (NBP1-57936)

Discover related pathways, diseases and genes to FUT6 Antibody (NBP1-57936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUT6 Antibody (NBP1-57936)

Discover more about diseases related to FUT6 Antibody (NBP1-57936).

Pathways for FUT6 Antibody (NBP1-57936)

View related products by pathway.

PTMs for FUT6 Antibody (NBP1-57936)

Learn more about PTMs related to FUT6 Antibody (NBP1-57936).

Blogs on FUT6

There are no specific blogs for FUT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FUT6 Antibody and receive a gift card or discount.


Gene Symbol FUT6