FUT6 Antibody - BSA Free

Western Blot: FUT6 Antibody [NBP1-57936] - Hela cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FUT6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FUT6(fucosyltransferase 6 (alpha (1,3) fucosyltransferase)) The peptide sequence was selected from the C terminal of FUT6. Peptide sequence YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FUT6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FUT6 Antibody - BSA Free

• alpha-(1,3)-fucosyltransferase
• EC 2.4.1
• FCT3A
• FCT3AFuc-TVI
• FLJ40754
• FT1A
• fucosyltransferase 6 (alpha (1,3) fucosyltransferase)
• Fucosyltransferase 6
• Fucosyltransferase VI
• Fuc-TVI
• FucT-VIEC 2.4.1.65
• FUT6
• Galactoside 3-L-Fucosyltransferase

Background

FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FUT6 Antibody (NBP1-57936)(1)

Publication using NBP1-57936

• Li D, Sun H, Bai G et al. a-1,3-Fucosyltransferase-VII siRNA inhibits the expression of SLex and hepatocarcinoma cell proliferation. Int. J. Mol. Med. 2018-11-01 [PMID: 30226570] (WB, Human)

Bioinformatics

• Gene Symbol: FUT6
• Uniprot:
  • P51993()