Recombinant Human FUSIP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FUSIP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human FUSIP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SRSF10

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FUSIP1 Protein

  • 40 kDa SR-repressor protein
  • FLJ43846
  • FUS interacting protein (serine-arginine rich) 1
  • FUS-interacting protein (serine-arginine rich) 2
  • FUS-interacting serine-arginine-rich protein 1
  • FUSIP1DKFZp686H0644
  • FUSIP2
  • neural-salient SR protein
  • NSSR
  • serine/arginine-rich splicing factor 10
  • serine-arginine repressor protein (40 kDa)
  • SFRS13
  • SFRS13A
  • Splicing factor SRp38
  • splicing factor, arginine/serine-rich 13
  • Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats
  • SR splicing factor 10
  • SRp38
  • SRrp40TLS-associated protein with SR repeats
  • TASR1TLS-associated SR protein
  • TASR2FUS interacting protein (serine/arginine-rich) 1
  • TASRFLJ30749
  • TLS-associated protein TASR
  • TLS-associated serine-arginine protein 1
  • TLS-associated serine-arginine protein 2
  • TLS-associated serine-arginine protein

Background

FUSIP1 - FUS interacting protein (serine-arginine rich) 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-34152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FUSIP1 Partial Recombinant Protein (H00010772-Q01) (0)

There are no publications for FUSIP1 Partial Recombinant Protein (H00010772-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUSIP1 Partial Recombinant Protein (H00010772-Q01) (0)

There are no reviews for FUSIP1 Partial Recombinant Protein (H00010772-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FUSIP1 Partial Recombinant Protein (H00010772-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FUSIP1 Products

Bioinformatics Tool for FUSIP1 Partial Recombinant Protein (H00010772-Q01)

Discover related pathways, diseases and genes to FUSIP1 Partial Recombinant Protein (H00010772-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUSIP1 Partial Recombinant Protein (H00010772-Q01)

Discover more about diseases related to FUSIP1 Partial Recombinant Protein (H00010772-Q01).
 

Pathways for FUSIP1 Partial Recombinant Protein (H00010772-Q01)

View related products by pathway.

PTMs for FUSIP1 Partial Recombinant Protein (H00010772-Q01)

Learn more about PTMs related to FUSIP1 Partial Recombinant Protein (H00010772-Q01).

Blogs on FUSIP1

There are no specific blogs for FUSIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FUSIP1 Antibody
NB110-93598

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FUSIP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SRSF10